SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022958 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022958
Domain Number 1 Region: 462-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-18
Family SPRY domain 0.003
Further Details:      
 
Domain Number 2 Region: 185-245
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.85e-18
Family B-box zinc-binding domain 0.00074
Further Details:      
 
Domain Number 3 Region: 6-52
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000895
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022958   Gene: ENSSSCG00000022110   Transcript: ENSSSCT00000027354
Sequence length 546
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL893304.1:65295:73677:-1 gene:ENSSSCG00000022110 transcript:ENSSSCT00000027354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAAVAMAPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELD
REEEEEDGEEEEVEAVGAGGGWDTPMRDEDYEGDMEEEVEEEEEGVFWTSXMDYVWEEED
EEEDLDYYLGDMEEDLRGEDEEDEEEVLEGKSFPRRSFRPNLQLANMVQVIRQMHPNPGR
GSRGNEQGICPKHQEALKLFCEVDEEAICVVCRESRNHKQHSVVPLEEVVQEYKAKLQGH
VEPLRKHLEAVQKMKAKEERRVTELKSQMKSELAAVASEFGRLTRFLAEERRLREMHEAQ
LGRAGAAASRLAEQAAQLSRLLAEAQERSQQGGLRLLQDIKETFNRCEEVQLQPPEVWSP
DPCQPHSHDFLTDAIVRKMSRMFCQAARGREVTCPTFLCLSLHRRKLGPGGVVGAVMGAG
CRQAKPKVAFVLAQVGVGVRVAARRTRDRKICLVCVLKTVGKEEVWCVGTNGKRYQAQSS
TEQTLLSPSEKPRRFGVYLDYEAGRLGFYNAETLAHVHTFSAAFLGERVFPFFRVLSKGT
RIKLCP
Download sequence
Identical sequences ENSSSCP00000022958 ENSSSCP00000022958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]