SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022965 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022965
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.49e-28
Family Carbonic anhydrase 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022965   Gene: ENSSSCG00000024705   Transcript: ENSSSCT00000030267
Sequence length 141
Comment pep:novel chromosome:Sscrofa10.2:13:47552390:47567524:1 gene:ENSSSCG00000024705 transcript:ENSSSCT00000030267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLWPEHWVTSSVSCGGRHQSPIDILDQHARVGEEYQELQLDGFDVESSNKTWMKNTGKTV
AILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEKLWISWLNGLT
QVDGFKPLVSLNTVSFFLFFF
Download sequence
Identical sequences ENSSSCP00000022965 ENSSSCP00000022965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]