SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022986 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022986
Domain Number 1 Region: 9-304
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.45e-90
Family Calpain large subunit, catalytic domain (domain II) 0.00000156
Further Details:      
 
Domain Number 2 Region: 506-657
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000317
Family Penta-EF-hand proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022986   Gene: ENSSSCG00000020986   Transcript: ENSSSCT00000031346
Sequence length 659
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL893019.2:17638:60376:1 gene:ENSSSCG00000020986 transcript:ENSSSCT00000031346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARNQEPLTQTSVIKLKEQDFYSLRDHCLKRGVLFEDETFPADTYSIGLQLLKGKNLSSL
SWIRPKDLLKGKSEPHFILEGASRFDIQQGDAGDCWFLAALGSLTQNPQHLQKILTDQSF
SYHYAGIFLFRFWQCGQWVEVVIXKEFLFVHPRNKREFWPCLLEKAYAKFHGSYANLHYG
YLSDALMDLSGGVVTNIRLHSSSSDLMMMVKTAAEAGSLITCGTLAGPTSESTMMVNGLV
SRHAYTVTGAEKIQYRKSWEYLIRLWNPWGRMEWRGPWSDGYGFWKPLSPSWRRGVTETL
FREGSICHAWCGSHCRSVQPTPLCDCQSISHSRDAHMDRLDSRYFPIQTHTYILANTVSG
LPGTSFHHNYSSLQCSDGISALLLGAAMFCLTSGPRHCLPFPSDFTIIAVKGIFSLLYSS
SFPPALFVSHHNQDTCDNENFRKGFKKRHEPQPEKYRVRSCDCSSKTPPHTPVYTPPPQV
HMHVYTHVSPQLLGTHVTPASLPRLNQGRFLDATQLQSLLNQEFLKGSPGDTFSLDECRG
IVALMDLEVNGRLNEQEFSRLWRRLVHCQSVFWNARKNSGVFLSSDLQKAIQDTDFLAGV
SVTSELLDLSTNPHSSGPHSSALRISKVERTEQAFQNLSQDGKGLYLTKMEWMNLVMYN
Download sequence
Identical sequences ENSSSCP00000021092 ENSSSCP00000022986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]