SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022993 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022993
Domain Number 1 Region: 320-474
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-47
Family SPRY domain 0.00017
Further Details:      
 
Domain Number 2 Region: 21-88
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000309
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 101-143
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000901
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022993   Gene: ENSSSCG00000020746   Transcript: ENSSSCT00000031979
Sequence length 477
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL895275.1:10468:20644:1 gene:ENSSSCG00000020746 transcript:ENSSSCT00000031979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGRGPRQGTEGGQXLALAAELQGEATCSICLELFREPVSVECGHSFCRACIARCWERPS
AGPTTVSRTLPYSLPCSLPCPQCREPXPGERGPLEAVSAGCAQHGEPLKLYCQDDVCDRA
REHRAHAVLPLDEARLRKAHELLESRLKVLKKDLEDYEAFRSTEEKESKELLKMFLPFRQ
KKRKEYEACTQHIVTQERYSLKRSQVRSESWRGQTRGEGKAALGSSGVNVKCLSLMGEPR
SKXNLSFQEFKNTLSKCSNVPAPKPTTVSSEMKNKVWNVSLKTFVLKGLLKKFKEDLRGE
LEKEEKGMMVIVTLTASVHILXLSLDLKSVRLGQRAQDLPSHPRRFDTNTRVLASCGFSS
GRHHWEVEVGSKDGWAFGVARESVRRKGLTPFTPEEGVWALQLNCGQYWAVTSPERTPLS
CGHLSRVRVALGLEVGAVSFYAAEDMRHIYTFRVNFQERVFPLFSVCSTGTYLRIWP
Download sequence
Identical sequences ENSSSCP00000022993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]