SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023033 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023033
Domain Number 1 Region: 720-856,919-1030
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.2e-56
Family Adenain-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023033   Gene: ENSSSCG00000021791   Transcript: ENSSSCT00000022387
Sequence length 1038
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:167016012:167153371:1 gene:ENSSSCG00000021791 transcript:ENSSSCT00000022387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIITEGKRKKSSSSELHKITKMLNAKPEDVCVQSPLSKLRSSERWDLPLQRWKRSLRNKV
LSLDHKSKKGVRGRPVTSKTSPERQLKVMLTNVLWTDLGRKFRKTLPRNDANLCDANKVQ
SESLPSTSVDSVETCQKLEPLHQSLNLSERIPRIILTNVLGTELGRKYIKTSSLTEASLG
DTDNLQSEQLSSSSDGSIESCQNLNPHKSSFLSERSSQPSKTVDNNYAEQAAHTKGKRGV
DDGIFLVISDTQPTDLSGGSRDCDHLEEGRRNKDDAYSDSKMEPTLIPRRRKKRLRSNLT
DSHNSTYLDKSAEQTKEQENDPTVCTEFEKSIENYHEDSKKLLEEITLEPTEGDFIEVSS
LHSQELALSAVPQITSDCSTTETFESSVSTDSAGNSPPVEKDENELNTIEQPVLSEHNEE
NQSFISAEPIVVSSDEEGPIEHKSSEILKLQPKQDHAITNENESTSEPAVSELPLITCES
VQASPELCTYNPVMENVSSIIPSNEMDLQLDFVFTSVYIGKIKGASKGCVTFTTKYIKIP
FQVSLHEISLLVDTTHLKRFGLWKSKDDDHSKRSHAILFLWVASNYLQEIQTQLENTLLS
QQPKSTEFIFLELHSSISQREELKLKDIMTEISTTNGELELSYPLSWVQALPLFQNLSSK
DSSFIHYYCASTCSFPAASAEEMKMKSMSQPSNTDTAKPTYTLLQKQSSGCYSLSITSNP
DEEWREVRHTGPVQKLIVYPPPPTKGGLAVTSEDLECLEEGEFLNDVIIDFYLKYLILEK
ASEELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWTRHINIFNKDYIF
VPVNESSHWYLAVICFPWLEEATYEDFSQTLSQHSQAQQSQPDKKTIDNDLHTSSTLSLG
TEDSQSPEMNVSVPKKRCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKTHREFS
KTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFELPIHLEKWFPRHVIKTKRED
IRELILKLHLQQQKGSSS
Download sequence
Identical sequences ENSSSCP00000023033 ENSSSCP00000023033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]