SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023085 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023085
Domain Number 1 Region: 312-586
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-45
Family YWTD domain 0.00000531
Further Details:      
 
Domain Number 2 Region: 11-50
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 3 Region: 52-89
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 4 Region: 94-139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 5 Region: 221-303,587-629
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000267
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 182-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 7 Region: 136-172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 8 Region: 638-673
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000457
Family EGF-type module 0.042
Further Details:      
 
Domain Number 9 Region: 675-713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000497
Family EGF-type module 0.042
Further Details:      
 
Domain Number 10 Region: 711-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000838
Family EGF-type module 0.046
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000023085
Domain Number - Region: 749-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00331
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023085   Gene: ENSSSCG00000023150   Transcript: ENSSSCT00000025492
Sequence length 810
Comment pep:known chromosome:Sscrofa10.2:5:24187618:24196236:-1 gene:ENSSSCG00000023150 transcript:ENSSSCT00000025492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCTPRCDMDQFQ
CKSGHCIPLRWRCDADADCMDGSDEEACSTGVRTCPLDEFQCNNTLCKPLAWKCDGEDDC
GDNSDENPEECARFVCPPNRPFRCKNDRVCLWIGRQCDGTDNCGDGTDEEDCEPPTAQSP
HCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSIDPKLTSCATNASICGDEARCV
RTEKAAYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCNNTKGGHLCSCARNFMKTHNT
CKAEGSEYQVLYIADDNEIRSLFPSHPHSAYEQAFQGDESVRIDAMDVHVKAGRVYWTNW
HTGTISFRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGIAIDWVAGNVYWTDSGR
DVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDGTLRETL
VQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPIVAADSKRGLSHPFSIDVFE
DYIYGVTYINNRVFKIHKFGHSPLINLTGGLSHASDVVLYHQHKQPEVTNPCDRKKCEWL
CLLSPSGPVCTCPNGKRLDNGTCVAVPSPTLPPDAPRPGTCNLQCFNGGSCFLNARRQPK
CRCQPRYTGDKCELDQCWEYCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQVCAGHCANN
STCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEGARC
EVNKCSRCLDGACVVNKQSGDVTCNCSDGR
Download sequence
Identical sequences ENSSSCP00000023085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]