SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023104 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023104
Domain Number 1 Region: 171-318
Classification Level Classification E-value
Superfamily TPR-like 1.9e-22
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 8-94,132-158
Classification Level Classification E-value
Superfamily FKBP-like 0.00000000000000187
Family FKBP immunophilin/proline isomerase 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023104   Gene: ENSSSCG00000022026   Transcript: ENSSSCT00000028258
Sequence length 329
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:52905783:52915377:1 gene:ENSSSCG00000022026 transcript:ENSSSCT00000028258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMDAALLLNVEGVKKTILHGGTGELPNFITGARVTFHFRTMKCDEERMVIDDSKQAGHPM
HIIVGNMFKLEVWETLLASMRVNEVAEFWCDTIHTGVYPMLSRSLRQVAEGKDPTEWHVH
TCGLANMFAYHTLGYEDLDELQKEPQPLIFVIELLQVEAPSQYQRETWNLSNDEKMQAVP
ILHGEGNRLFKLGRYEEASTKYQEAIVCLRNLQTKEKPWEVQWLKLEKMINTLILNYCQC
LLKKEEYYEVLEHTSDILRHHPGIVKAYYVRARAHAEVWNEAEAKADLEKVLELEPSMRK
AVQRELRLLENRLEEKREEERLRCRNMLG
Download sequence
Identical sequences ENSSSCP00000023104 ENSSSCP00000023104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]