SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023107 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023107
Domain Number 1 Region: 138-246
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000000000961
Family Papain-like 0.011
Further Details:      
 
Domain Number 2 Region: 89-153
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000617
Family VWC domain 0.064
Further Details:      
 
Domain Number 3 Region: 72-105
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000772
Family Somatomedin B domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023107   Gene: ENSSSCG00000001484   Transcript: ENSSSCT00000023260
Sequence length 250
Comment pep:novel chromosome:Sscrofa10.2:7:30957656:30982519:1 gene:ENSSSCG00000001484 transcript:ENSSSCT00000023260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RREWILVAVQVGVWMKRQSLSHREVDPRADFTRNHTILEGTRFKRAIFRGQYCRSFGCCE
DRDDSCVTPFYEANAVCYCDKFCERENSDCCPDYQSFCREEKEWRPHTKPWYPEGCHRDG
QHYEEGSVIKENCNSCTCSGQQWNCSQHVCLVQPGLIEHVNEGDFGWTAQNYSQFWGMTL
EEGFKYRLGTLPPSPLLLSMNEVTASLPETTDLPEFFVASYKWPGWTHGPLDQKNCAASW
AFSTASNKVI
Download sequence
Identical sequences ENSSSCP00000023107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]