SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023132 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023132
Domain Number 1 Region: 41-163
Classification Level Classification E-value
Superfamily TIMP-like 6.91e-55
Family The laminin-binding domain of agrin 0.000000536
Further Details:      
 
Domain Number 2 Region: 1832-2037
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.71e-38
Family Laminin G-like module 0.000000265
Further Details:      
 
Domain Number 3 Region: 1350-1551
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-36
Family Laminin G-like module 0.00063
Further Details:      
 
Domain Number 4 Region: 1603-1798
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.85e-31
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 5 Region: 471-538
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 5.54e-17
Family Ovomucoid domain III-like 0.0068
Further Details:      
 
Domain Number 6 Region: 175-245
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000132
Family Ovomucoid domain III-like 0.0041
Further Details:      
 
Domain Number 7 Region: 554-603
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000152
Family Ovomucoid domain III-like 0.0091
Further Details:      
 
Domain Number 8 Region: 1148-1226
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000235
Family SEA domain 0.0028
Further Details:      
 
Domain Number 9 Region: 251-321
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000222
Family Ovomucoid domain III-like 0.008
Further Details:      
 
Domain Number 10 Region: 621-668
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000319
Family Ovomucoid domain III-like 0.0077
Further Details:      
 
Domain Number 11 Region: 904-973
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000388
Family Ovomucoid domain III-like 0.0073
Further Details:      
 
Domain Number 12 Region: 401-465
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000457
Family Ovomucoid domain III-like 0.0047
Further Details:      
 
Domain Number 13 Region: 702-753
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000596
Family Ovomucoid domain III-like 0.004
Further Details:      
 
Domain Number 14 Region: 1546-1620,1800-1848
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000129
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 15 Region: 334-392
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000129
Family Ovomucoid domain III-like 0.0089
Further Details:      
 
Domain Number 16 Region: 796-839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000159
Family Laminin-type module 0.0042
Further Details:      
 
Domain Number 17 Region: 850-888
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000162
Family Laminin-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023132   Gene: ENSSSCG00000022204   Transcript: ENSSSCT00000026215
Sequence length 2039
Comment pep:novel chromosome:Sscrofa10.2:6:57851225:57880810:-1 gene:ENSSSCG00000022204 transcript:ENSSSCT00000026215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLRPSGSAPLQPLLLLLLLVVAARALPSADGTCPERALSRKEEANVVLTGTVEEILNV
DPVQHTYSCKVRVWRYLKGKDIVTQESLLDGGNKVVIGGFGDPLICDNQVSTGDTRIFFV
NPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEHCVEDKPGTHFTPVPPTPPDACRGMLC
GFGAVCEPSAEGPGRASCVCKKSTCPNVVAPVCGSDASTYSNECELQRAQCSQQRRIRLL
RRGPCGMRDPCSNITCSFGSTCARSSDGLTATCLCPATCLGAPESPVCGSDGTDYPSECQ
LLRHACARQENVFKKFDGPCDPCQGALNDLSRVCRVNPRTRHPEMLLRPESCPSRQAPVC
GDDGVTYDNDCVMGRTGATRGLLLQKVRSGQCLPRDQCPETCRFSAVCLSRRGRPRCSCD
RVICDGAYRPVCAHDGHTYDNDCWRQQAECQQQRSIPAKHQGPCDQPPSPCLGVQCPFGA
TCAVKNGEAECVCQQTCSGLYDPVCGSDGVTYGSACELEATACALGQEIRVARRGPCDRC
GQCRFGALCEAETGRCVCPSECVASAQPVCGSDGHTYASECELHVHACTHQISLHVASAG
HCQTCGESVCAFGAVCLAGQCVCPRCEHPPPGPVCGSDGVTYRSACELREAACQQQRQIE
EARGGPCEQAECGSGGSGSGEDGECEQELCRQRGGIWDEDSEDGPCVCDFSCQGVLRSPV
CGSDGVTYGTECELKKARCDSRQELYVVAQGACRSPTLAPRPPAVPLHCAQAPYGCCQDN
ITAARGVGLAGCPSSCQCNPHGSYSGTCDPATGQCSCRPGVGGLKCDRCEPGFWNFRGIV
TDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGHALGPAGCETDPSA
PKTCAEMPCEFGASCVEEAGSAHCVCPTPTCLGANATKVCGSDGVTYGNECQLRTIACRQ
GLDISVQSLGPCQEGIASGPRPTSASVAASWLDLSKALLPPASALPLAPSGSHLSQPASR
PSSQPWTTASIPRTTTRPVPTLPPTPPPAAASLAMSAFGESGSADGSSDEELSGDLEASG
AGSGGLLPPEGDGAGTPGPPAERASCYNSPVGCCSDGRTPSLDAEGSNCPATKVFQGVLE
LEGVEGQELFYTPEMADPKSELFGETARSIESALDDLFRNSDVKKDFRSIRLRDLGPGSS
VRAIVDVHFDPTTTFRAPDVGRALLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFFTG
ATPAAATARATTVARLPPSAAATRALYPSHTSRPVARTTAPLTTRQPPTTAPSRVPGRRP
LPPGTQKPPSPCDSQPCLHGGTCQDQGPGGAFTCSCPAGRGGTFCEEALPLSRPAFGGRS
FLAFPTLRAYHTLRLALEFRALEPEGLLLYNGNARGKDFLALALLGGRVQLRFDTGSGPA
VLTSSVPVQPGRWHRLELSRHWRRGTLSVGGRRPRGVQCHSGLREGVPLTPGPHLGGRVL
ERTSVSVGLRGCIRLLDVNNQRLELSAWQGSATRSSRVGECGDHPCVPSPCLGSAPCQAL
EAGMFHCQCPPGRFGPTCAEEKGPCQPNPCHGAAPCHVLPQGEAQCECPRGRGGSLCQTA
SERDDAMQPFLADFNSFSYLELKGLHTFERDLGEKMELEVVFLARGPSGLLLYNGQKTDG
KGDFVSLALHNRLLEFRYDLGRGRRSSGSKEPVALGVWTRVSLERNGRKGAMRVGDGPRV
LGESPVPHTILNLKEPLYIGGAPDFSRLARAAAVSSGFDGAIQLVALNGRQLLTREHVVQ
AVDVSSFADHPCTQAAGHPCLNGASCLPRGASYECLCPGGFSGLHCEKGLIEKSAGDLDA
LAFDGRTYVEYLNAVTESEKALQSNHFELSLRTEATQGLVLWSGKATERADYIALAIVDG
HLQLTYDLGSQPVVLRSTVAVNTNRWLRVRAHRDQREGSLQVGNEAPVTGSSPLGATQLD
TDGALWLGGLEKLPGGQALPKAYSTGFVGCLRDVVVGRRPLHLLEDAVTKPELRPCPTP
Download sequence
Identical sequences ENSSSCP00000023132 ENSSSCP00000023132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]