SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023133 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023133
Domain Number 1 Region: 15-344
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.8e-106
Family Calpain large subunit, catalytic domain (domain II) 0.000000157
Further Details:      
 
Domain Number 2 Region: 353-476
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.1e-21
Family Calpain large subunit, middle domain (domain III) 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023133   Gene: ENSSSCG00000027391   Transcript: ENSSSCT00000032309
Sequence length 557
Comment pep:novel scaffold:Sscrofa10.2:JH118557.1:71384:90284:1 gene:ENSSSCG00000027391 transcript:ENSSSCT00000032309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWSSLGGCWKLGCEDWMQSSSQLPKQDYEALQERCLIDGCLFEDQSFPATLRSIGGSG
SYSPPLIPILEGQFRLFPQELHSNPQFYSAKAKRLDLCQGLVGDCWFLAALQALTLHQDI
LSRVVPLNQSFTEKYAGIFRFWFWHFGKWIPVVVDDRLPVNEAGQLVFVSSTYKNLFWGA
LLEKAYAKLSGSYEDLQRGQVSEALVDFTGGVTMTINLVEAPCNLWDILTRAIYSRTLIG
CQTHAGKERVLENGLVDGHAYTLTGIRKVTSKHGPEYLVKLRNPWGKVEWKGDWSDSSST
WELLSPKERILLLRKENDGEFWMTLRDFKTHFTLLVICKLSPGLLSQEVGQTWLYTMLEG
RWEKGTTAGGQMRSPRDMFWKNPQFLLSVWRPQECRRLHMPCSVLVSLLQKPRHRHRNRK
PYLAIGFYLFRVGGLLMSSDPFLLVPVLFTLCARLLTSFSVYKNGVECLPLCLAPSWYLG
LVLFFLLREHWAFPKLLINLKRKIVFVEIGSSSSVVFSKEIVDPNEGQDEFFTKVFEKYP
EINAIQLQKILNRMPWS
Download sequence
Identical sequences ENSSSCP00000023133 ENSSSCP00000023133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]