SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023159 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023159
Domain Number 1 Region: 294-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-48
Family SPRY domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily RING/U-box 2.52e-28
Family RING finger domain, C3HC4 0.0068
Further Details:      
 
Domain Number 3 Region: 90-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.66e-18
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023159   Gene: ENSSSCG00000014672   Transcript: ENSSSCT00000032023
Sequence length 488
Comment pep:known chromosome:Sscrofa10.2:9:4689819:4720219:1 gene:ENSSSCG00000014672 transcript:ENSSSCT00000032023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSAVLVDIQEEVTCPLCLELLTDPLSIDCGHSFCQACITQNSEEWRMDQGGESSCPVCQ
TRYRPGNLRPNRHLANIAERLREVVLGSGTQLKVILCAHHGEKLQLFCREDGQLICWLCE
RAQEHRGHHTFLMEEVAQEYQEMLQAALRRLQKEQQKAEELEADIREQRTSCKYQMQTER
QRIRSEFNQLRCILDCEERRELQKLEEEERKTLDNLAAAEAELVQQTWLLKDLISDLECR
REWPTQELLQDTSGTMKWGEIWTLRKPKLVSKKLRRVFRAPDLGAMLQAQRELTHVQCYW
EDITLDPFNLNLNLVLSEDQRQVISVPIWPVKCYNYGVLGSQYFSSGKHYWEVDVSKKTA
WVLGVYCRARSCTAELALGRGAEHQNAHAIYRPQCGYWVIGLKNAFKYKAFEDASTCDLN
VLTLSGAVPPLRVGVFLDCEAGTVSFFNVTNYGSLIYRFSKCSFSQNVYPYFNPWNCPAP
MTLCPPSS
Download sequence
Identical sequences ENSSSCP00000023159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]