SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023223 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023223
Domain Number 1 Region: 3-178
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.69e-54
Family Eukaryotic proteases 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023223   Gene: ENSSSCG00000028936   Transcript: ENSSSCT00000031269
Sequence length 180
Comment pep:novel scaffold:Sscrofa10.2:GL895701.1:21:1472:1 gene:ENSSSCG00000028936 transcript:ENSSSCT00000031269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCQTLAVRSYRLHESYSPKTYQHDLALVRLKETADGCCAHPSPFVQPVCLPRSVASSAEP
EGALCEVAGWGHQFEGAEEYSSFLQEAQVPLISPERCSAADVHGAAFTPGMLCAGFLEGG
TDACQGDSGGPLVCEDETAERQLVLRGIVSWGSGCGDRLKPGVYTDVANYLAWIQEHTTS
Download sequence
Identical sequences ENSSSCP00000023223 ENSSSCP00000023223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]