SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023250 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023250
Domain Number 1 Region: 266-508
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.52e-39
Family Eukaryotic proteases 0.00064
Further Details:      
 
Domain Number 2 Region: 166-273
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-19
Family Hepsin, N-terminal domain 0.051
Further Details:      
 
Domain Number 3 Region: 132-170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000038
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023250   Gene: ENSSSCG00000025615   Transcript: ENSSSCT00000023996
Sequence length 516
Comment pep:known scaffold:Sscrofa10.2:GL893485.2:18935:32497:-1 gene:ENSSSCG00000025615 transcript:ENSSSCT00000023996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARILLSLIRSSLCEPGKGCVYRKLQISWVTVPSWYCLHFGGVRHHEVEVEVEPGIRGPEI
VTMGENDPPAAEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPILVVGIIA
LILALAIGLGIHFDCSGKYRCRSSFKCIELAARCNGVADCREGEDEYRCVRVSGRNAALQ
VFTAAAWRTVCSEDWKAHHASVACAQLGFPSYVSSDTLRVDLLEEPFREDFVSINHLLPD
DKVTALHHAVYVREGCASGHVVTLTCSACGRRMGSSPRIVGGNASSLAQWPWQASLQFQG
YHLCGGSVITPVWVVTAAHCVYDTAWPASLFALVGFPHCALRHPAGPMSWAWAPQAWRGR
KPQKILPYPVARVLVIPPPSLQDAPEAVCVTFLSLRFPSVTWVVLDRLVWVRGWPCPRSV
TGDASPVLNHAAVPLLSNKLCNHRDVYGXGYLKGGVDSCQGHSGRGLSPEERTVWKLVGA
TSFGIGCAEANKPGVYTRKALCVGWVWWQRGGDGSH
Download sequence
Identical sequences ENSSSCP00000023250 ENSSSCP00000023250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]