SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023281 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023281
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.49e-26
Family Arylsulfatase 0.042
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000023281
Domain Number - Region: 152-176
Classification Level Classification E-value
Superfamily dUTPase-like 0.0414
Family dUTPase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023281   Gene: ENSSSCG00000022732   Transcript: ENSSSCT00000026293
Sequence length 186
Comment pep:novel scaffold:Sscrofa10.2:GL896320.1:7387:20363:-1 gene:ENSSSCG00000022732 transcript:ENSSSCT00000026293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVANIDLGPTILDIAGYNLNKTQMDGMSFLPILKGASNLTWRSDVLVEYQGEGRNVTDP
TCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSHLWNLQYCEFDDQEVFVEVYNLTADPH
QINNIAKSIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNHGTVRTRR
FSKHLL
Download sequence
Identical sequences ENSSSCP00000023281 ENSSSCP00000023281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]