SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023313 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023313
Domain Number 1 Region: 188-295
Classification Level Classification E-value
Superfamily RING/U-box 2.12e-33
Family Zf-UBP 0.0000044
Further Details:      
 
Domain Number 2 Region: 331-408
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000000000000235
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023313   Gene: ENSSSCG00000025738   Transcript: ENSSSCT00000024882
Sequence length 425
Comment pep:known chromosome:Sscrofa10.2:13:126781319:126852323:-1 gene:ENSSSCG00000025738 transcript:ENSSSCT00000024882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRRGALFGMPGGSSSRKMAAGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEG
GLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDL
DTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPD
TWENELPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSG
GNGHALEHYRDLGYPLAVKLGTITPDGADVYSFQEEEAVLDPHLAKHLAHFGIDMLHMHG
TENGLQDNDIKPRVSEWEVIQETGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEF
QRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKVC
DCESA
Download sequence
Identical sequences ENSSSCP00000023313 ENSSSCP00000023313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]