SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023322 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023322
Domain Number 1 Region: 705-766
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000293
Family VWC domain 0.0035
Further Details:      
 
Domain Number 2 Region: 49-127
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000303
Family VWC domain 0.025
Further Details:      
 
Domain Number 3 Region: 787-856
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000565
Family VWC domain 0.06
Further Details:      
 
Domain Number 4 Region: 875-939
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000262
Family VWC domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023322   Gene: ENSSSCG00000025270   Transcript: ENSSSCT00000022487
Sequence length 958
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:131758179:131767012:1 gene:ENSSSCG00000025270 transcript:ENSSSCT00000022487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLLAPPAPLLLLGLLLLGSRLARGAGPESLALPIRPEKEPLPIRGAAGCSFGGKVYAL
DETWHPDLGEPFGVMRCVLCACEAPQWGRRARGAARVSCKNIKPECPTLACGQPRQLPGH
CCQTCPPERSGLEKQAPGLAFEYPRDPEHRSYSDRGEPGAEDRARGDGHTDFVALLTGPS
SQAAAPRVSLLRSNLRFSFSYRRLDRPTRIRFSDSTGGILFEHPASPTQDGLVCGVWRAV
PRSSLRLLRAEQLHVALVTPTHPSGEVWGPLIRHRALAAETFSAILTLEGPPQQGIGGIA
LLTLSDTEDSLHFLLLFRGLLESRSGGAAQVPLRLQILHQGKVLRELQANASAQELGFAE
VLPNLTAQEMDWLVLGELQMALERASGPGLRISGHIAARQSCDVLQSVLCGADALIPVQT
GAAGSASLTLLGNGSLIYQVQVVGTSSEVVAVTLETKPQRRNQHTVLCHMAGFQPGGHTA
VGVCPGLGARGAHMLLQNELFLNVATKDFPDGELRGHVAALPYSGHSARHDTLPVPLAGA
LVLPPVQSQAAGHAWLSLDTHCHLHYEVLLAGLGGSEQGTITAHLLGPPGMPGPRRLLKG
FYGPEAQGVVKDLEPELLRHLAQGTASLLITTKGSPQGELRGQVHIANQCEVGGLRLAAA
GTEEVQVPGAPDAMVAPAAVLPAVPGPDAPVPAKPGGPGRLRDPNSCFFEGQQRPHGARW
APNYDPLCSLCTCQRRTVICDPVVCPPPGCPSPVQAPDQCCPVCPGSTEKQDVRDLPGMP
RNRDPGEGCYFDGDRSWRAAGTRWHPVVPPFGLIKCAVCTCKGGTGEVHCEKVQCPRLAC
AQPVRVNPTDCCKQCPVGSGSHPQLGDPMQADGPRGCRFAGQWFPESQSWHPSVPPFGEM
SCITCRCGAGVPHCERDDCSLPLSCGPGKESRCCSHCTPQRPAETRTVPELEKDAEGS
Download sequence
Identical sequences ENSSSCP00000023322 ENSSSCP00000023322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]