SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023342 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023342
Domain Number 1 Region: 11-152
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.88e-24
Family Galectin (animal S-lectin) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023342   Gene: ENSSSCG00000022017   Transcript: ENSSSCT00000027266
Sequence length 188
Comment pep:novel chromosome:Sscrofa10.2:6:43232995:43239670:-1 gene:ENSSSCG00000022017 transcript:ENSSSCT00000027266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFVPAPGYQPTYNPTLPYYKPIPGGLRVGMSVYIQGVANEHMKRGASNPGTGRGPGSSL
HFSFSSSDGDKCWRQTRREGRWGAETTASAKALRQAWACPLRIIKIPGHYLVVVNGDPFY
EFGHRIPVQLVTHLQVDGDLTLQSINFIGGQPAPSPGPMPNPGYPGPGKHNQQPCNLPSM
EGSPTFNP
Download sequence
Identical sequences ENSSSCP00000023342 ENSSSCP00000023342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]