SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023361 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023361
Domain Number 1 Region: 294-480
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-31
Family SPRY domain 0.00017
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily RING/U-box 4.86e-27
Family RING finger domain, C3HC4 0.0045
Further Details:      
 
Domain Number 3 Region: 88-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.95e-16
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023361   Gene: ENSSSCG00000029712   Transcript: ENSSSCT00000029217
Sequence length 483
Comment pep:novel scaffold:Sscrofa10.2:JH118988.1:49556:62322:1 gene:ENSSSCG00000029712 transcript:ENSSSCT00000029217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGILENIREEVTCPICLELLKEPLSLDCGHSFCQDCLTVNSKKSMMGLEGKSNCPVCR
VSYQPGNLRLNRHVANIVERLRKVSLSPEVEQKGNLCVHHEEKLLFFCKEDGKVICWICE
RSQQHCDHQTFLVEEVAQEYQKKLQDALERLQEEQKEAEKLEAQVREEVSAWKNQIQSEQ
QNVQAEFMRLRGILENEELKEMQMLKDEEKVILSDLADSKDELAQQTQLVGELISEVERR
LLGSKLEMLQDVNDILKRSETLTLKKPKAFPKEQRRVFRAPDLREILCVFNKLTDVRRYW
VHVTLNNLKIKSDVTISVDRRQVRYARKFGLSSTCPNGDFEDCSVLGYPLISSGKHXAWI
LGVYGRKLSNCLFCFSKSNQHPYWRYKPKYGYWVIWLNDKGEYNTFEESSSSDSGPLTLS
LGVPPRRIGVFLEYEAGTVSFFNITNHGSLIYRFSSCPFSQATFPYFNPMKCHIPMILCS
PGS
Download sequence
Identical sequences ENSSSCP00000023361 ENSSSCP00000023361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]