SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023412 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000023412
Domain Number - Region: 354-435
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000132
Family Autophagin-like 0.011
Further Details:      
 
Domain Number - Region: 154-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000566
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 3-35
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0191
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023412   Gene: ENSSSCG00000029995   Transcript: ENSSSCT00000025750
Sequence length 578
Comment pep:novel scaffold:Sscrofa10.2:GL896259.2:14552:35727:1 gene:ENSSSCG00000029995 transcript:ENSSSCT00000025750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSCDICGETVTSEPDMKAHLIVHMEDDVICPFCKLSGVSYDEMCFHIETAHFEQNELER
NIERINSVQYGTSDNRTDSTLQCRMEVNSSIHSACASNHPKILAQSLPKEGSLKHKGFHS
ENVTESRKFLKSKEKQSDLTKIKGSIYETMYSPPECPFCGKIEDCSQDMETHVKTKHTNL
LDTPLEDCDEPLYDCPMCGLICTNYHILQEHVDLHLEESGFGQGMDRVQCSRDLELAQQL
QQEEDRKRRSEESRQEMEEFRKLQRQYGLDNSGGYKQQQLRNMEIEVNRGKMHPSEFHRR
KADMMESLAIGIDDGKTKTSGIMEALYRYYQNAATDVRRVWLSTVVDHFHSSFGDKGWGC
GYRNFQMLLSSLLQNDAYGDCLKDMSVPCIPKIQSMIEDAWKEGFDPQGASQLNNRLQGT
KAWIGACEVYTLLTSLRIKCRIIDFHKSTGPLGTHPRLFEWILNYYSSEREGSPKVVCTS
KPPIYLQHQGHSRTIVGIEERKNRTLCLLIFDPGWPSRDMQKFLKQDMEASSLKQLRKFV
GNLKHKQYQIVAVEGVLSSEEKIARRQASQVFTAEKIS
Download sequence
Identical sequences ENSSSCP00000023412 ENSSSCP00000023412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]