SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023414 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023414
Domain Number 1 Region: 277-446
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-40
Family SPRY domain 0.00014
Further Details:      
 
Domain Number 2 Region: 5-73
Classification Level Classification E-value
Superfamily RING/U-box 8.33e-16
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 3 Region: 83-145
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000014
Family B-box zinc-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023414   Gene: ENSSSCG00000027255   Transcript: ENSSSCT00000024759
Sequence length 448
Comment pep:novel chromosome:Sscrofa10.2:9:25759116:25766630:1 gene:ENSSSCG00000027255 transcript:ENSSSCT00000024759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKSFQNEFTCSLCDKYFIDPVTLGCGHSFCMPCLCLSWEEEAQHPPRCPVCKEKSHQM
NLKTNIVLMTRVFLARRTGPYDLPSPEEQTCETHMKPKNFYCEVTKDVLCLPCSKTKEHV
AHLHCSIEWTAEEYRQKLLKQMRCLWVKIQQNERNLRRETSKIRNWEDYVTLRKTTIIAE
YWNICQFIDQKEKRYLQRLDEESKEIFQQLQESQYNMDLMGNLLRGLYEELKDLCHKPDM
QMIQRFEIMLKRSEKLQLHVPQPVVPQLSSCPITGLMGWLEQFQVYFASDKETVTRHVPV
FEDLQRWLSGPDCPGVDYTPTRLKYFLAWGAESFTSGQHYWEVNVAGCCNWAIGLCNDSW
AKKNDMALESEGIFLLFCIQENQQCSLFTSSPLTPQYVQRPLGQVGVFLDHEAGLVSFID
VATSSLICSFLSCSFSSSLKAFLCSGHP
Download sequence
Identical sequences ENSSSCP00000023414 ENSSSCP00000023414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]