SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023477 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023477
Domain Number 1 Region: 82-147
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000172
Family Laminin G-like module 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023477   Gene: ENSSSCG00000028718   Transcript: ENSSSCT00000031767
Sequence length 149
Comment pep:novel chromosome:Sscrofa10.2:7:108478261:108652250:1 gene:ENSSSCG00000028718 transcript:ENSSSCT00000031767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLRIHARRSPPRRPAWTLGIWSLFWGCIVSSVWSSSNVASSSSSSSPGSHSQHEHHFHG
SKHHSVPISIYRSPVSLRGGHAGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTV
KDGILVRIDSAPGLGDFLQLHIVSTRLWP
Download sequence
Identical sequences ENSSSCP00000023477 ENSSSCP00000023477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]