SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023508 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023508
Domain Number 1 Region: 597-655
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000278
Family BSTI 0.05
Further Details:      
 
Domain Number 2 Region: 982-1041
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000311
Family BSTI 0.058
Further Details:      
 
Domain Number 3 Region: 1371-1430
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000132
Family ATI-like 0.018
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000023508
Domain Number - Region: 2088-2129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00184
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023508   Gene: ENSSSCG00000024215   Transcript: ENSSSCT00000032235
Sequence length 2158
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:53419236:53492824:1 gene:ENSSSCG00000024215 transcript:ENSSSCT00000032235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYSSLLKIWVSFIFALVRHQVQPRELMYPFWQNDTKTPKVDDGSSSEIKLAMPIFFFGV
PYRTVYVNNNGVVSFNVLVSQFTPESFPLTDGRAFIAPFWADVHNGIRGEIYYRETMDPV
ILKRATKDIRKYFKDMATFSATWVFIVTWEEVTFYGGSSTTPVNTFQAVLVSDGSYTFTL
FNYYEINWTTGTASGGDPLTGLGGVMAQAGFNGGNLTNFFSLPGSRTPDIVNIQETTNVN
VPGRWAFKIDGKEIDPANGCTSRDSPGQFLRRGEVFWDDLNCTIKCRCLDFNNEIYCQEA
LCSPYEVCEPKGKFFYCSPVETSTCVVFGEPHYHTFDGFLFHFQGSCAYLLARQCLQTSS
LPFFSVEAKNEHRGGSAVSWVKELLVEVNGYKILIPKGSYGKVKVNDLVASLPITLDLGA
VKIYQSGMSTAVETDFGLLVTFDGQHYASISIPGSYINSTCGLCGNYNKNPLDDFLRPDG
RPAMSVLDLGESWRVYHADWKCDSGCVDNCTQCDPATEALYFGSDYCGFLNKTDGPLGEC
GTVVDPTAFVHSCVYDLCSVRDNGTLLCQAIQAYALVCQALGIPIGDWRIQTGCVSTVQC
PNFSHYSVCTSSCPDTCSDLTASQNCAVPCTEGCECNEGFVLSTSQCVPLHKCGCDFDGH
YYAMGEFFWATANCTVQCLCEEGGDVYCFNKTCRGGEVCAVEDGYQGCFPKRETVCLLSQ
NQVLHTFDGAAYAFPAEFSYTLLKTCPEGPEYLEIDINKKKPDAGPAWLRGVRILVADQE
VKIGGLGAAEVKLNGQEVELPFFHPSGRLEIYRNKNSTTVESKGIVTVQYSDVGLLYIRL
STAYFNCTGGLCGFFNANASDEFCLPNGKCTDNLAVFLESWTTFEEICNGECGDLLKACN
NDSELLKFYRSRSRCGLINDPSNSSFLECHSVVNVTAYYRTCLFRLCQSGGNESELCDSV
ARYASACKNADVEVGPWRTHDFCPLECPENSHFEECMTCTETCETLALGPICVDSCSEGC
QCDEGYALQGSQCVARSECGCNFEGHQLATNETFWVDLDCQIFCYCNGTDNSVHCETIPC
KSDEYCLEEGGLYYCQARTDASCIVSGYGHYLTFDGYPFDFQTSCPLILCTTGSRPSSDT
FPKFIVTAKNEDRDPSLALWVKQVDVTVFGYSIVIHRAYKHTVLVNSERLYLPLKLGQGK
INIFSFGFHVVVETDFGLKVVYDWKTFLSVTVPRSLQNSTSGLCGRYNGNPDDDLELPMG
VLASSVNEFGQSWVKRDTFCQVGCGDRCPSCAKVEGFSKVHQLCSLIPSQNSGFTKCHSK
VNPTFFYKNCLFDSCVDGGAVQTACSWLQNYASTCQTQGIAVTGWRNYTSCSVTCPPNSH
YESCVSVCQPRCAAIRLKSDCNHYCVEGCQCDAGYVLNGKSCILPHSCGCYSDGKYYEPK
QLFWNSDCTRRCRCFRRNLIQCDPRQCKSDEECALRNGVRGCFSTKTSYCLAAGGGVFRT
FDGAFLRFPASCAFVLSTICQKLPDISFQLIINFDKWSSPNLTIISPVYFYINEEQILIN
DRNTVKVNGTQVNVPFITGLATKIYSREGFLVIDTSPDIQIFYNGYNVIKISISERLQNK
VCGLCGNFNGDLTDDYVTLRGKPVVSSVVLAQSWKTNGMQKRPLAPSCNELQFSQYAAMC
DNVHIQMMQGDGYCLKLTDMKGFFQPCYGLLDPLPFYESCYLDGCYNQKKFQLCGSLAAY
GESCRSFGILSTEWIEKENCSGVVEDPCVGADCPNRTCELENGGELCGCIEPPPYGNNSH
DIIDAEVTCKAAQMEVSISKCKLFQLGFEREGVRVNDRQCTGIEGEDFISFQINNTKGNC
GNIVQSNGTHIMYKNTIWIESANNTGNIITRDRTINVEFSCAYELDIKISLDSVVKPMLS
VINLTVPTQEGSFTTKMALYKNASYKHPYRQGEVVLTTRDVLYVGVFVVGADSTHLILTL
NKCYATPSRDSNDKLRYFIIEGGCQNIKDNTIGIEENGVSLTCRFHVTVFKFIGDYDEVH
LHCAVSLCDSEKYSCKINCPQNSRIATDYTKEPKEQIISVGPIRRKRLDWCEDNGGCEQI
CTSRVDGPLCSCVTGTLQADGKSCRASNSSIELQIWTLLLLMTQISLWRFVYKSGMTS
Download sequence
Identical sequences ENSSSCP00000023508 ENSSSCP00000023508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]