SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023530 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023530
Domain Number 1 Region: 369-407,460-777
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.34e-89
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023530   Gene: ENSSSCG00000021305   Transcript: ENSSSCT00000026503
Sequence length 915
Comment pep:novel scaffold:Sscrofa10.2:JH118963.1:91478:120912:1 gene:ENSSSCG00000021305 transcript:ENSSSCT00000026503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVNQVTHDQAVVLQSALQSIPNPSSECMLRNVSIRLAQQISDEASRYMPDICVIRAIQ
KIIWASGCGALQLVFSPNEEITKIYEKTNAGHEPDLEDEQVCCEALEVMTLCFALIPTAL
DALSKEKAWQTFIIDLLLHCHSKTVRQVAQEQFFLMCTRCCMGHRPLLFFITLLFTVLGS
TARERAKHSGDYFTLLRHLLNYAYNSNINIPNAEVLLNNEIDWLKRIRDDVKRTGETGVE
ETILEGHLGVTKELLAFQTPEKKYHIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGEL
PAEQAIPVCGSPSTINAGFELLVALAVGCVRNLKQIVDSLTEMYYIGTAITTCEALTEWE
YLPPVGPRPPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNGILAIEGTGSDVDDDMSGDE
KQDNESNVDPRDDVFGYPQQFEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYV
PRGFWKQFRLWGEPVNLREQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKI
CQGCPHRYECEESFTTLNVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKR
LLIKKLPPVLAIQLKRFDYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDNVNQE
SQLIKQNEQSDSETAGSTKYRLVGVLVHSGQASGGHYYSYIIQRNGGDGERNRWYKFDDG
DVTECKMDDDEEMKNQCFGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERLDTIDQGD
ELIKYISELAITTRPHQIIMPSAIERSVRKQNVQFMHNRMQYSLEYFQFMKKLLTCNGVY
LNPPPGQDHLLPEAEEITMISIQLAARFLFTTGFHTKKIVRGSASDWYDALCILLRHSKN
VRFWFAHNVLFNVSN
Download sequence
Identical sequences ENSSSCP00000023530 ENSSSCP00000023530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]