SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023539 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023539
Domain Number 1 Region: 26-268
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.21e-26
Family Eukaryotic proteases 0.0000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023539   Gene: ENSSSCG00000026223   Transcript: ENSSSCT00000023012
Sequence length 270
Comment pep:novel chromosome:Sscrofa10.2:5:17363962:17380469:1 gene:ENSSSCG00000026223 transcript:ENSSSCT00000023012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLLVVASLVLYAHKGHSTQDFPETNARVVGGTEAQRNSWPSQVGVPSRPQTSMNKRLG
GGDLNTNHIYTPNDTTCATRATLFARLTHQTPHTYTHTHTHTHTYTHTWQSKNKIGQLGF
DVSNLKTGKLMVNSHTLRGIIAIRGLLTGPMNPIHISSQWGKTLKTGGKAAPAGQDRYLS
KERLSICHESSVLGATTTTTTTTKAKGQKKKKICDGDSGGPLHCLVNGQYAVHGVTSFVS
RLGCNVTRKPTVFTRVSAYISWINNVIASN
Download sequence
Identical sequences ENSSSCP00000023539 ENSSSCP00000023539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]