SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023563 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023563
Domain Number 1 Region: 142-242
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000581
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 4-169
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000691
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023563   Gene: ENSSSCG00000027634   Transcript: ENSSSCT00000023278
Sequence length 249
Comment pep:novel chromosome:Sscrofa10.2:13:78326811:78337832:1 gene:ENSSSCG00000027634 transcript:ENSSSCT00000023278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSCFPGYAIMADGVSCEDINECVTDMHTCSRSEHCVNTVGSFRCYKALTCEPGYMLKDG
ECTDVDECELGTHSCQVGFTCQNTKGSFYCQPRQRCMDGFLQDPEGNCVDINECTSLSEP
CQPGFSCVNTVGSYTCQRNPLICGRGYHASQDGTKCVDVNECETGVHHCSETQVCHNLPG
SYRCDCKAGFQRDAFGRTCIDVNECWASPSRLCQHTCENTLGSYRCSCASGFVLAADGKH
CEGTGLCTA
Download sequence
Identical sequences ENSSSCP00000023563 ENSSSCP00000023563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]