SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023568 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023568
Domain Number 1 Region: 367-481,601-747
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.61e-66
Family Phosphate binding protein-like 0.000000000547
Further Details:      
 
Domain Number 2 Region: 9-343
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.69e-52
Family L-arabinose binding protein-like 0.0077
Further Details:      
 
Domain Number 3 Region: 497-600
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000251
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023568   Gene: ENSSSCG00000024685   Transcript: ENSSSCT00000022356
Sequence length 854
Comment pep:novel chromosome:Sscrofa10.2:8:48116708:48277325:1 gene:ENSSSCG00000024685 transcript:ENSSSCT00000022356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTL
HVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDS
AAEKKWQVTAINVGNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIG
KHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPG
AHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERA
LKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGND
TSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVG
DGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKK
PQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSE
STNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTV
ERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTT
AEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAV
NLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLA
MLVALIEFCYKSRAEAKRMKMTLSDAMRSKSRLSITGSTGENGSVMTPEFPKAVHAVPYV
SSGMRMNVSVTDLS
Download sequence
Identical sequences ENSSSCP00000023568 ENSSSCP00000023568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]