SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023572 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023572
Domain Number 1 Region: 29-352
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.75e-33
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023572   Gene: ENSSSCG00000023174   Transcript: ENSSSCT00000024667
Sequence length 1108
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:112155302:112193360:-1 gene:ENSSSCG00000023174 transcript:ENSSSCT00000024667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWVKFLRKPGGNLGKAYQPGSMLSLAPTKGLLNEPGQNSCFLNSAVQVLWQLDIFRRSL
RVLTGHVCQGDACIFCALKTIFAQFQHSREKALPSDNIRHALAESFKDEQRFQLGLMDDA
AECFENILERIHFHIVPSRDADMCTSKSCITHQKFAMTLYEQCVCRSCGASSDPLPFTEF
VRYISTTALCNEVERMIERHERFKPEMFAELLQAANTTDDYRKCPSNCGQKIKIRRVLMN
CPEIVTIGLVWDSEHSDLTEDVVRNLATHLYLPGLFYRVTDENARNSELHLVGMICYTSR
HYCAFAFHTKTSKWVFFDDANVKEVGTRWKDVVSKCIRCHFQPLLLFYANPDGTAVSTED
ALKQVIIWSHHKSVAENIGCENSSISKSENSKENGFGDQTKQRENQRFQVDSISSFTRSH
IQTSGGRGPVKSSHNDQREKIKDISRECALKAIEQKNLLSSQRKDLERGQRRDLGRQRDL
VDEDLPHFKSGSPPVSNGFRQYGNSHLYHSQGKGPYKHDRVAHQSRASAQTLSSSKCQIL
ASGEKVTGKVKSDSGTGYDTDSSQDSRDKGSSYNGSSKSRNRGWKPMRETLNVDSIFNES
ERRQHSPRHKSNISNKSKCSKDQSFNNWPKENPKQKCLMTIYEDETKQETGSRSSLEFNG
KGTEKNKGLKETKVHGDSWQMQRTESGYESSDHISNGSANLDSPIIDGNGTVTDISGSKE
AASFSDKIKTGNLNIEHVNSTSQQSKNHLEGFRRELKNLEVDCKSHESHSESHLQIKNPL
IKRSHVRETNGKLFSSSSPQIPKDHTAREHAYLSNEQKLEKSSECKFSEWPNVENPERTG
LLFHVDDNSASGKRVNSNETVSPSSLQSSLMRTVGLKPETAPVLQQQNMTEQCYSENSLS
REKLIQSTRRSDGCQMPKPFCQNPPPPLPPKKYVKTSVPQSEKNDSTPDVKLTEMFKTNC
SNLPKHSLSTASGPGLEVNAYMNDERPKETFQAKEDFSHIPSSFSTNDFQADSSTVAGAL
CQPEIDSGSSCPNETVSLTTYFSVDNCMTDTYRLKYHQRPKLCFPENSGFCNNSISQSER
GLGPVSHTNLGSNCPSKQRYKPGIHCSR
Download sequence
Identical sequences I3LHM5
ENSSSCP00000023572 ENSSSCP00000023572 XP_003357091.1.46622 XP_013844793.1.46622 XP_013844795.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]