SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023573 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023573
Domain Number 1 Region: 435-964
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.73e-132
Family alpha-mannosidase, C-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 35-353
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.95e-98
Family alpha-mannosidase 0.00000852
Further Details:      
 
Domain Number 3 Region: 357-464
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 2.16e-25
Family alpha-mannosidase, domain 2 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023573   Gene: ENSSSCG00000027178   Transcript: ENSSSCT00000023041
Sequence length 974
Comment pep:known chromosome:Sscrofa10.2:8:3060886:3103162:-1 gene:ENSSSCG00000027178 transcript:ENSSSCT00000023041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSPRLLAAGMGPHSWLPLFMQLALLGPQWALHFYKVKVFVVPHSHMDVGWLHTVQESMQ
VYVPDVYNSVVEALTRGKRRRFIAVEQEYFRLWWDGFASAKRKQQVRQLLAEQRLEFVLG
GQVMHDEAVTHFDDQILQLTEGHGFLYETFGIRPQFSWQVDPFGASATTPTLLALAGFNG
HIISRIDYDLKDAMQHAQGLQFVWRGSRSLEARQEIFTHVLDQYSYCSDGFMWNGSPRFP
DRPFDMDYSAVEMPVSQDSMNHYVLNLVDNVNKRAAWFRTQHVLWPWGCDRQFFNASQQF
ANMDRLMDHINKHTPELGISMQYATLAEYFQAVFAQDVSWQVRDHRDFLPYSSAPEQTWT
GFYTSQSGLKRLARRASALLYAGESLFTRYMLSAARRFLDPAWALTQLQQLRWAVSEVQH
HDGITGTHILAVRDMFVEHLTTGMAGVRKLMDSIAQDMPLTHSGPEPGGHVAMVYNPLAW
TVTTVITLTVSFPEVSVTDESGRPVLAQVQDSKETPSAYDLHVLTTIPGLSYQHYIIRPI
RKAREDSQEAAATVPSTIQFGLKLRRQDGQVGRNLVPVKNGCYTVFLDKDTNLMHSIWER
QSNRTVRMSQEFLAYCSVYGYEEAVTSDNYLFTPNGTAEPAWAAVRMEVVEGQLLSEIRQ
YFYRQANDSDHTYAIYSRLAHGPQDSAGELLCHRIEQEYRVGPLELNHEVVLRTSTSLNT
GLVLYSDNNGYQMQRRTYRHDRNNSVSLNYYPMAQSAFIQDGGSRLVLLSEQAHGVSSQG
NGQVEVMLHRRLWNKLEWTLQYNLTHDVTSVVRPVLWLLLGPRTLTTGLRQRSGLELQHR
PVVLFRELGGTVQNGPGPRKQEPVTLPPSLHLQILSIPGWKYSSNHTVHLKNLQKGHYRR
AKADFRRVLLRLHHLYEAGEHQALSRPVTLNLQSVLRGLGSVVAVEERSLTGTWDVNSLH
RWSWKTEDGHHHRG
Download sequence
Identical sequences ENSSSCP00000023573 ENSSSCP00000023573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]