SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023652 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023652
Domain Number 1 Region: 187-303
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 2.35e-42
Family eIF-2-alpha, C-terminal domain 0.000000614
Further Details:      
 
Domain Number 2 Region: 90-183
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.31e-33
Family eIF2alpha middle domain-like 0.00000188
Further Details:      
 
Domain Number 3 Region: 11-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.43e-17
Family Cold shock DNA-binding domain-like 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023652   Gene: ENSSSCG00000027990   Transcript: ENSSSCT00000030998
Sequence length 315
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:97394872:97421380:1 gene:ENSSSCG00000027990 transcript:ENSSSCT00000030998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTT
TLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEV
DGDDDAEEMEAKAED
Download sequence
Identical sequences A0A1S2ZX01 A0A286XNR5 A0A287A096 E2RL17 G1T2G4 H0XRJ5 I3LYT8 K9IX89 L8HMQ9 P68101 P68102 Q6ZWX6
ENSRNOP00000013375 ENSSTOP00000001402 ENSOGAP00000018737 ENSEEUP00000009314 ENSEEUP00000009314 ENSBTAP00000040899 ENSSSCP00000023652 10090.ENSMUSP00000071214 10116.ENSRNOP00000013375 10141.ENSCPOP00000002993 9615.ENSCAFP00000034264 9823.ENSSSCP00000002486 9913.ENSBTAP00000040899 9986.ENSOCUP00000010342 ENSRNOP00000013375 ENSOCUP00000010342 ENSBTAP00000040899 ENSCAFP00000034264 ENSCAFP00000034264 ENSMUSP00000071214 ENSCPOP00000002993 ENSMUSP00000071214 ENSSTOP00000001402 NP_062229.1.100692 NP_062229.1.4139 NP_080390.1.92730 NP_787007.1.59421 NP_787007.1.76553 XP_001928374.1.46622 XP_002719561.1.1745 XP_003472406.1.53824 XP_003797431.1.62490 XP_004426317.1.5094 XP_004584520.1.84141 XP_004681822.1.23501 XP_005211998.1.76553 XP_005322867.1.77405 XP_005399142.1.28644 XP_005399143.1.28644 XP_005399144.1.28644 XP_005623592.1.84170 XP_005686052.1.57651 XP_005877973.1.60319 XP_005911547.1.15283 XP_005911548.1.15283 XP_006041878.1.26621 XP_006041879.1.26621 XP_006091056.1.53796 XP_006186511.1.101512 XP_006760841.1.95426 XP_007525877.1.11023 XP_008137154.1.99482 XP_008850369.1.79516 XP_010845034.1.44457 XP_010845035.1.44457 XP_010960587.1.22495 XP_010974921.1.51371 XP_012580125.1.23501 XP_013377426.1.28644 XP_015096985.1.17985 XP_015345782.1.40921 XP_016079294.1.3490 XP_019496858.1.44202 XP_019824645.1.53367 XP_019824646.1.53367 XP_021506861.1.76796 ENSMUSP00000071214 ENSOGAP00000018737 ENSSSCP00000023652 ENSCPOP00000002993 ENSOCUP00000010342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]