SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023658 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023658
Domain Number 1 Region: 615-914
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.15e-84
Family Protein kinases, catalytic subunit 0.00000000103
Further Details:      
 
Domain Number 2 Region: 29-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.5e-73
Family Ephrin receptor ligand binding domain 0.000000954
Further Details:      
 
Domain Number 3 Region: 325-530
Classification Level Classification E-value
Superfamily Fibronectin type III 9.63e-41
Family Fibronectin type III 0.0000742
Further Details:      
 
Domain Number 4 Region: 909-979
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000105
Family SAM (sterile alpha motif) domain 0.0015
Further Details:      
 
Domain Number 5 Region: 253-317,363-379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000269
Family Growth factor receptor domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023658   Gene: ENSSSCG00000026130   Transcript: ENSSSCT00000022760
Sequence length 984
Comment pep:known chromosome:Sscrofa10.2:13:177406602:177810115:-1 gene:ENSSSCG00000026130 transcript:ENSSSCT00000022760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCHLSILLLLSCSVLNCFGELILQPSNEVNLLDSKAIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFIKIDTIAADESFTQMDLGDRILKLNTEVREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCSCNAGYEERGFMCEACRPGFYKASDGNMKCAKCPPHSSTHEDG
SVNCRCENNYFRADKDPPSMACTRPPSAPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGWNVKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAINGVSELSS
PPRQFAAVSITTNQAAPSPVMTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTTYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGENS
QVVMIAISAAVAIILLTVVTYVLIGRFCGYNKSKHGADEKRLHFGNGHLKLPGLRTYVDP
HTYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGY
TEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFT
VIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAY
TTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDE
GYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPS
NLLLDQSNVDITTFRTTGDWLNGVRTAQCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVV
GPQKKIISSIKALETQSKNSPVPV
Download sequence
Identical sequences D3K5K5
ENSSSCP00000023658 ENSSSCP00000023658 NP_001182264.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]