SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023715 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023715
Domain Number 1 Region: 266-598
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.63e-110
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000000000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023715   Gene: ENSSSCG00000015120   Transcript: ENSSSCT00000024719
Sequence length 606
Comment pep:known chromosome:Sscrofa10.2:9:51595405:51614008:-1 gene:ENSSSCG00000015120 transcript:ENSSSCT00000024719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQLSSTLKRYTESARYTDAPYAKSGYGTYTPSSYGANLAASFLEKEKLGFKPGPSTSFL
TRPRTYGPPSILDYDRGRPLLRPDIIGGGKRAESQTRGTERPSGSGLSGGSGFPYGVTTS
SLSYLPVNARDQGVTLTQKKSNSQSDLARDFSSLRTSDSYRLDPGNLGRSPMLARTRKEL
CALQGLYQAASRSEYLADYLENYGRKGSTPQVPTQAPLSRVPEVLSPTYRPSGRYTPWEK
SKGQTPVSSRSSSPGRDTMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRL
YMRDLSHSSSAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQ
EFLRFLLDGLHNEVNRVTVRPKSSPEGLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQL
KSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRC
RARKRCIKKFSVQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENINHA
VYNLYAVSNHSGTTMGGHYTAYCRSPVTGEWHTFNDSSVSPMSSSQVRTSDAYLLFYELA
SPPSRM
Download sequence
Identical sequences I3LI16
ENSSSCP00000023715 ENSSSCP00000023715 XP_005667490.1.46622 XP_005667491.1.46622 XP_020918633.1.46622 XP_020918634.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]