SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023767 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023767
Domain Number 1 Region: 306-492
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.86e-24
Family YicI N-terminal domain-like 0.025
Further Details:      
 
Domain Number 2 Region: 64-144
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.18e-17
Family Putative glucosidase YicI, domain 3 0.019
Further Details:      
 
Domain Number 3 Region: 1-61
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000000611
Family YicI catalytic domain-like 0.05
Further Details:      
 
Domain Number 4 Region: 278-330
Classification Level Classification E-value
Superfamily Trefoil 0.00000000241
Family Trefoil 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023767   Gene: ENSSSCG00000021108   Transcript: ENSSSCT00000032326
Sequence length 495
Comment pep:novel chromosome:Sscrofa10.2:13:112742553:112767743:1 gene:ENSSSCG00000021108 transcript:ENSSSCT00000032326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLGAFYPFSRNHNAQGYEHQDPAFFGQNSLLVNSSKHYLNIRYTLLPFLYTLFYKAHMF
GETVVRPILHEFYEDTNSWIEDTQFLWGPSLLITPVLKQGASTVSAYIPNATWYDYETGA
KRPWRKQRVDMYLPADKIGLHLRGGYIIPIQQPAVTTTASRKNPLGLIVALDEYNTAEGD
FFWDDGETKDTIQNGSYIFYTFSVSNNKLDIMCTHSSYQEGTTLAFETIKILGLIDAVTE
VSVVEGDQPMSAHYNFTYDASNQYLLIYNLKFNLGRNFTVQWDQTFLDAEKFTCYPDTDT
ITKELCEERGCLWQESHLESKAPECFFPKEDNSYLVQSTQYSSLGVTADLQLNTASTRIK
LPSDPIPTLRVEVKYHKDYMLQFKIYDPQNKRYEVPVPLNIPTTPTSTYENRLYDVEIKE
NPFGIQIRRRSTGKVIWDSRLPGFAFNNQFIQISTRLPSEYIYGFGEVEHTAFKRDLNWN
TWGMFTRDQPPGVGT
Download sequence
Identical sequences ENSSSCP00000023767 ENSSSCP00000023767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]