SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023772 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023772
Domain Number 1 Region: 251-319
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.05e-19
Family TB module/8-cys domain 0.00096
Further Details:      
 
Domain Number 2 Region: 129-254
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-18
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 3 Region: 412-541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000107
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 14-141
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000785
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 777-881
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000115
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 683-813
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000549
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 7 Region: 327-458
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000502
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 8 Region: 601-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000809
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 647-685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000127
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023772   Gene: ENSSSCG00000022967   Transcript: ENSSSCT00000032576
Sequence length 881
Comment pep:novel chromosome:Sscrofa10.2:2:71520324:71544991:-1 gene:ENSSSCG00000022967 transcript:ENSSSCT00000032576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPVSPDHNECATTTMCANGVCLNEDGSFACLCKPGFLLAPGGRHCMDIDECQTPGICMNG
HCTNTEGSFHCRCLGGLMVGADGRFCFYINECALNPDICANGMCENLRGSYRCICNLGYE
VGVAGKECQDVDECALNSLLCDNGRCWNSPGSYSCSCPQGFSFRQDTETCEDIDECLSNP
CVNGVCRNLAGSYACECAPGSRLGPSGTVCLDVNECEVFPGVCTNGHCLNTAGSFRCQCP
EGLTLDATGRLCVDVRLELCYLRWDEDECGAALPGKYRMDVCCCSVGAAWGATCEACPKP
ESAAFASLCPRGLGFASRDFLSGRPFYKADVNECKAFPGLCAQGTCRNTVGSFHCSCAGG
FALDAQERNCTDIDECHISPDLCGQGTCVNTPGSFECECFHGYESGFMLILPDVDECARD
PLLCRGGTCTNTDGSYECHCPPGHALAMGTACEDIDECSLSDGLCPHGHCVNVIGAFQCS
CHHGFQSTADLQGCVDVNECEENPDICDNGQCTNEPGGHRCLCYNGFVATLDMRTCVVTH
QTFHREAYVGKADTRSLSRPMQVGETQLGTWWSVPGYLCPEPVHQAMQQMCPGCPIRTEP
TDVDECDLNPHICLHGDCENTRGSFVCHCQLGYVIRKGATGCSDLDECELGGHSCDSHAS
CLNIPGSFSCRCQPGWVGDGFECHDRDECAFQEHGCSPRADCLNIPGSYRCSCHPGFTGD
GFSCEDRDECAENVDLCENGQCLNAPGGYRCECEMGFNPTEDQRACQDVDECVLGNLCVF
GICENLPGMFRCVCDEGYELDRRYPQCTDVNECADPVNCINGLCVNTPGSYQCNCPQDFE
LNPSGVGCVDIDECQELPGLCQGGDCVNTFGSFQCQCPPGY
Download sequence
Identical sequences ENSSSCP00000023772 ENSSSCP00000022942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]