SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023882 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023882
Domain Number 1 Region: 7-56
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000000000412
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023882   Gene: ENSSSCG00000021365   Transcript: ENSSSCT00000032578
Sequence length 57
Comment pep:novel scaffold:Sscrofa10.2:JH118508.1:62461:65494:-1 gene:ENSSSCG00000021365 transcript:ENSSSCT00000032578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SXSVQGYTTKTKQEVEISRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLIKNIEYPVX
Download sequence
Identical sequences ENSSSCP00000023882 ENSSSCP00000023882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]