SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023964 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023964
Domain Number 1 Region: 2536-2822
Classification Level Classification E-value
Superfamily BEACH domain 4.84e-122
Family BEACH domain 0.0000000473
Further Details:      
 
Domain Number 2 Region: 2903-3095,3243-3280
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.4e-32
Family WD40-repeat 0.001
Further Details:      
 
Domain Number 3 Region: 2380-2502
Classification Level Classification E-value
Superfamily PH domain-like 5.1e-19
Family PreBEACH PH-like domain 0.015
Further Details:      
 
Domain Number 4 Region: 324-369,396-592
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000645
Family Armadillo repeat 0.076
Further Details:      
 
Domain Number 5 Region: 949-1092
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000929
Family Glycosyl hydrolases family 16 0.055
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000023964
Domain Number - Region: 33-67,108-170,226-454
Classification Level Classification E-value
Superfamily ARM repeat 0.00138
Family Armadillo repeat 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023964   Gene: ENSSSCG00000010383   Transcript: ENSSSCT00000026607
Sequence length 3282
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:97178324:97427141:1 gene:ENSSSCG00000010383 transcript:ENSSSCT00000026607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETLGRVAESGLPALLLQCLYLFFVFPLEKDELFESDIQVQRMFVQMLINICSETQGLEGL
LSGNELQSLMIATTCLREHSCSFWKEPTFCVLKAISKAQNLSVIQYLQAMDCIKISLQNL
SRLADALPVPEVSEAMNLVLGFVKDSYSISPALFLEFENGEGYPLLLKVLLRYDELTQTE
ADPHLEELLGLVVWLTTCGRSELKVFDSVTYPQLEGFKFHHEASAFSGVTVKNLQAFQVL
QNAFHKASDSILCTKVLSSIRAMWAWNARNFFLLEWTLQPISQFVEIVPLKPTLVQMHFF
QLLETLVFELHYVPHEILRKVQRLIKESPEPLFTLVALQSILRIAGGDPLFTDIFRDSGL
LGLLLAQLRKQAKILRKSECFLNMAGNREFNPRVEDTERELTCVMLRTVVTLLKGSVRNA
VVLKDHGMVPFIKIFLDDECYRGASLSILEQLSVINAEEYMSIIVGALCSSTQGELQLKL
DLLKSLLRILETPKGRAAFRVSSGFNGLLSLLSDLEGSLQEPPLQTWGVVSPSQTLELVL
HTLCALSAALHLDPVNGNFFRRNGLYEKLAEDLCLLGCFGAVEEEDAPLHSWEDTKVRPF
ADLLSAAFSSGSLLPPKIQSCLQILGFLDSMARGTLHLRRDLKDSPRARQEPVVDAQSGA
PTPIGSPLLPVKRHAFKYVQSSRMFEKSSVCDLRLVLWFFPLFLLTDEGDPVIMHPGVLC
IMVRLLPRLYHEDHPQLSEEIQCSMASHIQSLVKSQRNRQVMCEAGMLRTLMTSCHQPLS
TGNSPLHSRLIRIFEKLASQAIEPDVLRQFLGLGIPSPPSAATKVLNSSPVHGGDPGCSG
ASCHHGSTLSKSAEGLGWRVSWEGPGGHPHVIQASRPSGQTQGSTTALQTALSLISMTSP
RNLQPQRAALAPSFVEFDMSVEGYGCLFIPTLSTVMGTSTEYSVSGGIGTGAARSFPPPG
GLTFSCWFLISRHSAVTEGHPLRFLTLVRHLSRTEQPFVCFSVSLCPEDLSLVVSTEEKE
FQPLDVMEPEDDLEPSAGRQLRVRCGQLLACGQWHHLAVVVSKEMKRNCTVSTYLDGQVI
GTAKMLYIQVLPGPFLSMDPSSFVDVYGYIATPRVWKQKSSLIWRLGPAYLFEEAISVET
LEVINKLGPRYCGNFQAVQAQGEDPSMEVLPLVAEERVSFGLHIASSSVTSAADIRNTYN
EVDSRLIAKEMNISSRDNAMPVFLLRNCAGHLSGSLRTIGGVAVGQLGVRVFHSSPAASS
LDFIGGPAILLGLISLATDDHTMYAAVKVLHSVLTSNVMCDRLMQHICGYQIMAFLLRKK
TSFLNHRIFQLILSIAGTAELGFGSSAVINVGVFQHILCNFELWMNAADNLELSLFSHLM
EILQSSREGPRNAEVAHQARLIPKLVFLFNEPGLTPSKMPTIIAILGCQLRGHFSLQDLL
RIGLFVVYTLKPSSVNERQICVDGAADPSMPDLNFLSVAGSQTSGKTIWLRNQLLEMLLS
VISSSQLHLSSETKEEIFLNLGPDWFLLFVQGHLHPSTVVLGLKLLLHFLSSPSLLGRFK
DGLSAGSWVERSSEEMNERVGNRLDVVPPSPPSTDNLKSHPPMLDQSSCLLPGFRVLSDL
LAHHVHIPEVYLIVSTFFLQTPLTELTDGPKVQLEKSHNSRGSLGSCQDSLDAMLQWLLH
MHRKEEVVRAGLCTEGALLLLEMLKATMSQPPAGPGESAWERTFPASVLQFLGLVHSTYP
QDPAWRAPEFLQTLAAVTFPLGTHKISQFKITLNSLIKGAMTESAQNISGPEAETEGDST
VEGLQVPAESHPTQKQLREFMQLLLRELLLGSSNPKQWLPLEVLLEASPDNATIQQKRDF
QSEVLLSTMEIFHVTSGGRAPMLRGEDTQLPTGTTGSHPTLVANISHFTQKLVEKLYSGM
FSADPRHILLFIMEHIMVQSKYSEKDSTISALYSSLNKVILYCLSKPQQSLSECLSLLNV
LGFLQEHWDIIFATYNSNASFLLCLMHCLLLLSTRSYPEGFGLESKPRVTPYHQFILPKK
MQPDPGQHKSQVQHNIQKVVRTLWQQLVAQRRQELEDTVKIDLSVKPGESEVKIEEVTPL
WEETMLKAWQYYLGYSKPEVNVGSTGVPRAAVPYGIKTQTNPVPSLLLSQVCPEGPNPQL
IRSWLFSAHVDIIHDLATGKQVKNIYEMEKNESKNLTTSSAWARIQEQLFGELGLWGQTA
DATPCPQWELDWREGPARMRKRLRRLSDLFYSNLSHLSPVSQSIIKGRKKGWRQGSSQAC
RSGTCRQAGGAPAPCLPEKMSCHPSATERSTRHISPQKTPADQGNMLRPLLLAPQSLGEG
GTSQGGERLGGTWAWSGVIKKSKKKKHLCIHRLSLEEFKKVTQKYSLVIVQGHLVCEGLL
LFGQQHFYICENFTLSPMGDVYCTRHCLSNISDPFIFNMCSKDRSSDNYSCQRHSYGDLR
ELRQARFLLQDIALEIFFQNGYSKFLVFYNRDRSKVFKRFLSGVPTFTCHTSQKTDCAPN
PSIVSGDQVRRYPGSDRTMLQKWQKRDISNFEYLMHLNTMAGRTYNDYMQYPVFPWVLAD
YSSQTLNLTNPKTFRDLSKPMGAQTKERRLKFIQRFKEVEKTEGDMTVQCHYCTHYSSAI
IVASYLVRMPPFTQAFCSLQGGSFDVADRMFHSMKNAWESASRENMSDVRELTPEFFYLP
EFLTNCNALEFGCMQDGTALGDVQLPPWADGDPRKFISLHRQALESDFVSANLHHWIDLI
FGYKQQGSAAVEAVNTFHPYFYGDKMDLSSIRDPLIRSTILGFVSNFGQVPRQLFTKPHP
ARTAAGKPSPGKDVSTPASLHGHPQPFFYSLQSLRPSQVTVKGSESPKGAIGHIVPTDKT
ILAVETNKMLLPPHWSRTFSWGFDDFSCCLGNYGSDKILMTFENLAPWGRCLCAVCPSPT
VIITSGASAVVCVWELSIAKGRPTGLRLKQALYGHTQAVTCLAASVPFNLLVSGSQDRTC
ILWDLDRLTHVSRLPAHREGISAIAISDISGTIVSCAGAHLSLWNVNGQPLASITTAWGP
EGAITCCCVMEGPAWDTNHVIVTGSQDGMVRIWKTEDVKMSVPRQAAPEEPWALPPSPRG
NCPGLAQPSLPSSLLGPGIAAPPRPAEPREAIEPLGMLRGQDTVSWWSIKEGETPSRAWS
DTLHLPGPSGLLCIPGPVILHKEVPMHSWVSPQDQHSYTRTKPGHRWEKNLALCRELDVS
VALTGKPNKTNSAVTALAVSRNQTKLLVGDEKGRIFCWSAEG
Download sequence
Identical sequences ENSSSCP00000023964 ENSSSCP00000023752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]