SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024161 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024161
Domain Number 1 Region: 414-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-54
Family Eukaryotic proteases 0.0007
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-32
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 3 Region: 280-350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000389
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 234-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000288
Family EGF-type module 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024161   Gene: ENSSSCG00000028338   Transcript: ENSSSCT00000029479
Sequence length 720
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:27877535:27954885:1 gene:ENSSSCG00000028338 transcript:ENSSSCT00000029479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGWWPQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKKE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKTCRNGSWGGTLDDFYVKGIYCAECRAGW
YGGDCMRCGQVLRVPKGQILLESYPLNAHCEWTIHAKPGFIIQLRFIMLSLEFDYMCQYD
YVEVRDGDNSDGQIIKRFCGNERPAPIRSTGSSLHVLFHSDGSKNFDGFHAIFEEITACS
SSPCFHDGTCLLDSTGSYRCACLAGFTGQHCENLLEERNCSDPGGPVNGYKEITGGPGLI
NGRYAKIGTVMSFFCNNSYVLSGNEMRTCQQNGEWSGKQPICIKACREPKISDLVRRRVL
PMQVQSRETPLHQLYSSAFSKQKLQDTLTKKPALPFGDLPPGYQHLHTQLQYECISPFYR
RLGSSRRTCLRTGKWSGRAPSCVPICGKTENVTSPKTQGTRWPWQAAIYRRASGVHGGSL
HKDAWFLVCSGALVNERTVVAAAHCVTELGRVTVIKTADLKVVLGKFYRDDHRDEKSIQS
LRISAIILHPNYDPILLDADIAVLKLLDKARISSRVQPICLAASRDLSTSFQEARITVAG
WNILADARSPGFKNDTLRSGVVRVADSLLCEEQHEDHGIPVSVTDNMFCASWDPTAPSNI
CTAETGGIAAVSFPGRASPEPRWHLVGLVSWSYDKTCTHSLYTAFTKVLPFKDWIERNMK
Download sequence
Identical sequences ENSSSCP00000024161 ENSSSCP00000024161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]