SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024170 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024170
Domain Number 1 Region: 124-232
Classification Level Classification E-value
Superfamily Kringle-like 9.67e-34
Family Kringle modules 0.00075
Further Details:      
 
Domain Number 2 Region: 267-343
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.68e-18
Family Eukaryotic proteases 0.01
Further Details:      
 
Domain Number 3 Region: 24-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000734
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000024170
Domain Number - Region: 1-18
Classification Level Classification E-value
Superfamily Kringle-like 0.00262
Family Fibronectin type II module 0.023
Further Details:      
 
Domain Number - Region: 105-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00644
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 60-95
Classification Level Classification E-value
Superfamily FnI-like domain 0.0649
Family Fibronectin type I module 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024170   Gene: ENSSSCG00000024208   Transcript: ENSSSCT00000030232
Sequence length 344
Comment pep:known scaffold:Sscrofa10.2:GL896163.1:668:2928:-1 gene:ENSSSCG00000024208 transcript:ENSSSCT00000030232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQK
EKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQT
EGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTA
EQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSP
SEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNRI
VGGLVALPGAHPYIAALYWGQNFCAGSLIAPCWVLTAAHCLQNR
Download sequence
Identical sequences ENSSSCP00000024170 ENSSSCP00000024170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]