SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024192 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024192
Domain Number 1 Region: 60-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3e-69
Family Lectin leg-like 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024192   Gene: ENSSSCG00000026939   Transcript: ENSSSCT00000032030
Sequence length 350
Comment pep:known scaffold:Sscrofa10.2:GL896308.1:62698:85959:-1 gene:ENSSSCG00000026939 transcript:ENSSSCT00000032030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IALSYGPANRWQRWWRRLSTRDGSRMLLLLLLLGSGQGPRQVGAGQTFEKYIRRQKKNVI
KPQRGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFRIH
GQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAM
VNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCI
EVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMK
LPEMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY
Download sequence
Identical sequences ENSSSCP00000024192 ENSSSCP00000024192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]