SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024250 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024250
Domain Number 1 Region: 507-576
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.22e-19
Family TB module/8-cys domain 0.00065
Further Details:      
 
Domain Number 2 Region: 1242-1313
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.05e-18
Family TB module/8-cys domain 0.00043
Further Details:      
 
Domain Number 3 Region: 1606-1677
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.14e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 4 Region: 91-212
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.02e-18
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 5 Region: 1684-1818
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.1e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 2013-2141
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.81e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 269-411
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 1403-1529
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.59e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 9 Region: 5-131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.95e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 210-283
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.06e-16
Family TB module/8-cys domain 0.00082
Further Details:      
 
Domain Number 11 Region: 583-713
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 12 Region: 402-486
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.54e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 13 Region: 873-1008
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000126
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 14 Region: 1082-1155
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000157
Family TB module/8-cys domain 0.0000464
Further Details:      
 
Domain Number 15 Region: 712-849
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000275
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 16 Region: 964-1092
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000424
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 17 Region: 1161-1216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000964
Family EGF-type module 0.00064
Further Details:      
 
Domain Number 18 Region: 2138-2254
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 19 Region: 1969-2017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000545
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 20 Region: 1567-1620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000117
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 21 Region: 1320-1374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000402
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 22 Region: 1800-1850
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000165
Family EGF-type module 0.02
Further Details:      
 
Domain Number 23 Region: 1522-1564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000256
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 24 Region: 1363-1401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000587
Family EGF-type module 0.01
Further Details:      
 
Domain Number 25 Region: 836-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000205
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000024250
Domain Number - Region: 2348-2394
Classification Level Classification E-value
Superfamily Cadherin-like 0.0051
Family Cadherin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024250   Gene: ENSSSCG00000014256   Transcript: ENSSSCT00000025170
Sequence length 2433
Comment pep:known chromosome:Sscrofa10.2:2:136503755:136602304:-1 gene:ENSSSCG00000014256 transcript:ENSSSCT00000025170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPCTNG
DCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFE
LTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGI
CMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSE
CCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENL
RGSYRCNCNSGYEPDPSGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTET
ETCEDINECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRC
EVNINGATLKSECCATLGAAWGSPCERCELDTACPRGFARIKGVTCEDVNECEVFPGVCP
NGLCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCC
AVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDVLTGRPFYKDINECKAFPGMCTYG
KCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYE
SGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDVNECSLS
DNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECS
CSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVN
ECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNV
PGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTC
SDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCN
NLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPT
GVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNST
EYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEET
RICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGT
TCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAV
DIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADC
INSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQ
DQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRN
GRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGY
EVKSENCIDINECDEDPNICLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQSFCFTN
FENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHD
TREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGT
CTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALRE
DQKMCKDLDECTEGLHDCESRGMMCKNLIGTFMCICPPGMTRRPDGEGCVGKALEDDVTH
LIHLCQGRFTHLIKKISHDAPDNTDLKKTSTYSPPLPNTYYPSAPASLSSLINCHPLPQS
SPLPCLVSGGKLIPFGVQLSISLPNITTSLKRESPHRLHYLFFDFWCTDIDECKVMPNLC
TNGQCINTMGSFRCFCKVGYTTDISGTSCVDLDECSQSPKPCNFICKNTEGSYQCSCPRG
YVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPS
LCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCP
QGYIQHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECS
SSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFNKGQYLSLDADTDEENALSPE
TCYECKINGYSKKESRQKRSLHEPRPTASGEQISLESVDMDSPVKMKFNLSGLGSKEHIL
ELMPAIEPLNNHIRYVISQGNDDGTFRIHQKNGLSYLHTAKRKLVPGTYTLEITSISLYK
KKELKKLEDSNEDDYLLGELGEALRMRLQIQLY
Download sequence
Identical sequences ENSSSCP00000024250 ENSSSCP00000015165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]