SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024343 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024343
Domain Number 1 Region: 1-197
Classification Level Classification E-value
Superfamily GFP-like 1.88e-78
Family Domain G2 of nidogen-1 0.00000000824
Further Details:      
 
Domain Number 2 Region: 209-289,325-378
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000024343
Domain Number - Region: 295-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0552
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024343   Gene: ENSSSCG00000026819   Transcript: ENSSSCT00000028752
Sequence length 381
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:59336243:59454745:1 gene:ENSSSCG00000026819 transcript:ENSSSCT00000028752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHGRSYTAISTIPETIGYSLLPLAPIGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVT
FVGHPDKLVIKQQFSGIDEHGHLTIDTELEGRVPHIPFGSSVHIEPYTELYHYSRQVITS
SSTREYTVMEPEQDSTAPSHVHTYQWRQTITFQECVHDDSRPALPSTQQLSVDSVFVLYN
QEERILRYALSNSIGPVRDGSPDALQNPCYIGTHGCDTNAACRPGPGTQFTCECSIGFRG
DGRTCYDINECSEQPAVCGSHAICNNHPGTFRCECVEGYRFSEEGTCVAVVDQRPINYCE
TGLHDCDIPERAQCIYLGGALYTCSCLPGFSGDGRACQDVDECQPSRCHPDAFCYNTPGS
FMCQCKPGYQGDGFRCVPGGK
Download sequence
Identical sequences ENSSSCP00000024343 ENSSSCP00000024343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]