SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024376 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024376
Domain Number 1 Region: 26-638
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 1.57e-229
Family Aconitase iron-sulfur domain 1.84e-16
Further Details:      
 
Domain Number 2 Region: 642-896
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 2.75e-84
Family LeuD-like 0.000000000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024376   Gene: ENSSSCG00000023807   Transcript: ENSSSCT00000023699
Sequence length 898
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:38194852:38240593:-1 gene:ENSSSCG00000023807 transcript:ENSSSCT00000023699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCPRGRTRTMSNPFAHLAEPLDPAQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCD
QFLVKKDDVENILNWNVLQHENIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNP
EKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFRNMRIIP
PGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVML
GQPISMVLPQVIGYKLMGNPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIA
DRATIANMCPEYGATAAFFPVDEVSIKYLVQTGRDEDKVKHIKKYLQAVGMFRDFSDSSQ
DPDFAQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQIAPDHHND
HKTFIYDNSEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVKPYIKTSL
SPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEAVVEAITQGDLVAVGV
LSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGMNAKGQQVFLKDIWP
TRDEIQAVERQFVIPGMFKEVYQKIETVNESWNALEAPSDTLYSWNPKSTYIKSPPFFED
LTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPRDFNSYGS
RRGNDAIMARGTFANIRLLNKFLNKQAPQTIHLPSGEVLDVFDAAERYQQAGLPLIILAG
KEYGSGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTG
RERYTISIPETLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFHNGGILNYMIRKMAK
Download sequence
Identical sequences ENSSSCP00000024376 ENSSSCP00000024376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]