SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024388 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024388
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.71e-44
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024388   Gene: ENSSSCG00000028737   Transcript: ENSSSCT00000029412
Sequence length 137
Comment pep:known chromosome:Sscrofa10.2:1:119570757:119579181:-1 gene:ENSSSCG00000028737 transcript:ENSSSCT00000029412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYLRNKVDTYVEFPLRGLDMKCYLLE
PENSGPENCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEDTVVKAKA
YILFYVERQAKAGSDKL
Download sequence
Identical sequences ENSSSCP00000019579 ENSSSCP00000024388 ENSSSCP00000019579 ENSSSCP00000024388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]