SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024395 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024395
Domain Number 1 Region: 27-330
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.91e-108
Family Papain-like 0.0000000000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024395   Gene: ENSSSCG00000023666   Transcript: ENSSSCT00000026923
Sequence length 335
Comment pep:known chromosome:Sscrofa10.2:14:16202844:16223503:-1 gene:ENSSSCG00000023666 transcript:ENSSSCT00000026923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRLLATLSCLVLLTSARESLHFQPLSDELVNFINKQNTTWTAGHNFYNVDLSYVKKLCG
TFLGGPKLPQRAAFAADMILPKSFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDR
ICIRSNGRVNVEVSAEDMLTCCGDECGDGCNGGFPSGAWNFWTKKGLVSGGLYDSHVGCR
PYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYTPSYKEDKHFGCSSYSISRNEKEIM
AEIYKNGPVEGAFTVYSDFLQYKSGVYQHVTGDLMGGHAIRILGWGVENGTPYWLVGNSW
NTDWGDNGFFKILRGQDHCGIESEIVAGIPCTPHF
Download sequence
Identical sequences A1E295
ENSSSCP00000024395 ENSSSCP00000024395 NP_001090927.1.46622 XP_005657323.1.46622 XP_005657324.1.46622 XP_013845747.1.46622 XP_020927422.1.46622 XP_020927423.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]