SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024444 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024444
Domain Number 1 Region: 1-303
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.08e-71
Family L-arabinose binding protein-like 0.000000691
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000024444
Domain Number - Region: 313-370
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0178
Family Growth factor receptor domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024444   Gene: ENSSSCG00000023891   Transcript: ENSSSCT00000031304
Sequence length 615
Comment pep:novel chromosome:Sscrofa10.2:13:70590017:71008682:1 gene:ENSSSCG00000023891 transcript:ENSSSCT00000031304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAGGLCIAQSVRIPQERKDRTIDFD
RIIKQLLDTPNSRAVVIFANDEDIKQILAAAKRADQVGHFLWVGSDSWGSKINPLHQHED
IAEGAITIQPKRATVEGFDAYFTSRTLENNRRNVWFAEYWEENFNCKLTISGSKKEDTDR
KCTGQERIGKDSNYEQEGKVQFVIDAVYAMAHALHHMNKDLCADYRGVCPEMEQAGGKKL
LKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTTNPGYRLIGQWTDELQLNIED
MQWGKGVREIPPSVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMTCQHCPYDQR
PNENRTGCQDIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGREL
SYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGK
KSVTAPRLISPTSQLAITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLK
CDITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIF
FGTAQSAEKVSENAH
Download sequence
Identical sequences ENSSSCP00000024444 ENSSSCP00000024444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]