SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024479 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024479
Domain Number 1 Region: 21-249
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.81e-84
Family Eukaryotic proteases 0.00000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024479   Gene: ENSSSCG00000030539   Transcript: ENSSSCT00000022589
Sequence length 250
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:51477327:51483273:-1 gene:ENSSSCG00000030539 transcript:ENSSSCT00000022589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLLTSHLIFSFLLTCAGAQDDSDKARGEECAPHSQPWQVALFEHGRFNCGASLISPNW
VLTAAHCQTRGMRVRLGEHNLRKRDGPEQLRAVARIIPHPRYEERSHRHDVMLLRLLRPA
HLSAKVHPIPLPTRCPRPGEACVVSGWGLVPESQVSLPDTLHCGNISVISTASCNKDYPG
CLLNTMVCAGVEGGGTDSCEGDSGGPLVCGGVLQGIVSWGDVPCDTTTKPGVYTKVCSYL
EWIKETMKRN
Download sequence
Identical sequences ENSSSCP00000024479 ENSSSCP00000024479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]