SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024487 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024487
Domain Number 1 Region: 1224-1400
Classification Level Classification E-value
Superfamily AbfB domain 4.05e-21
Family AbfB domain 0.013
Further Details:      
 
Domain Number 2 Region: 888-952
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000523
Family ATI-like 0.027
Further Details:      
 
Domain Number 3 Region: 781-851
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000867
Family BSTI 0.031
Further Details:      
 
Domain Number 4 Region: 2384-2447
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000589
Family BSTI 0.03
Further Details:      
 
Domain Number 5 Region: 472-519
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000136
Family VWC domain 0.056
Further Details:      
 
Domain Number 6 Region: 429-479
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000213
Family ATI-like 0.095
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000024487
Domain Number - Region: 951-991
Classification Level Classification E-value
Superfamily FnI-like domain 0.000105
Family VWC domain 0.069
Further Details:      
 
Domain Number - Region: 1415-1469
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000327
Family BSTI 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024487   Gene: ENSSSCG00000013376   Transcript: ENSSSCT00000030282
Sequence length 2938
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:44517891:44610409:-1 gene:ENSSSCG00000013376 transcript:ENSSSCT00000030282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPAPAFCLLLACVWLPPGEPVGEPVPVQSLGERNVDWRGRKDLRGCREDGGDAGGVSC
QACFSSSHSHQEAIPAIGDATTVMGRQEAEALDSLAMSSWERRLHRAKCAPSYLFSCFNG
GECVHPAFCDCRRFNATGPRCRMGSVYNTGPERDSICRAWGQHHVETFDGLYYYLSGKGS
YTLVGHHEPEGQTFSVQVHNDPQCGSSPYTCSRSVSLFFAGEQEIHLAKEVTHGGVRVQL
PHVMGSLHLQQLAGYVLVRHQSAFTLAWDGASAVYIKMSPEFLGWTHGLCGNNNADPQDD
LVTSYGKLTDDVAEFVHSWQEQAPNQPPGPTTSTLPRPPCLQQNPGTMQGVYDRCEALLR
PPFDACHAYVSPLPFTASCTSDLCQSAGDEATWCRALAEYARACAQAGRPLQGWRNQLWQ
CMVRCKEKAFIYNECIACCPASCQPRASCVDSEIACVDGCYCPDGLIFEDGGCVAPAECP
CEFHGTLYPVGSVVKEDCNTCTCTAGKWVCSTSVCPAECSVTGDIHFTTFDGRRYTFPAT
CQYILAKSRSSGTFTVTLQNAPCGLNQDGVCVQSVSVILHQDPRRQVTLTQAGDVLLFDQ
YKVTPPYTDDAFEIRRLSSVFLRVKTNVGVQVLYDREGLRLYLQVDQRWVEDTVGLCGTF
NGNTQDDFLSPVGVPESTPQLFGNSWKTLSACSPLVSGSPLDPCDVHLQAASYALQSCSV
LTGDLFAPCSVYLSPVPYFEQCRRDACRCGQPCLCATLAHYAHLCQRHGLPIDFRTRLPA
CALSCEATKEYSPCVAPCGQTCQDLASPEACGVEGGSDLRGDECVEGCACPPDTYLDTQA
DLCVPRNQCSCHFQGMDYPPGDSDIPSLGHCHCKDGVMSCDSRAPAAACPAGQVFVNCSD
LHTDPELSRERTCEQQLLNLSVPARGPCLSGCACPQGLLRHEDACFLPEECPCTWKGKEY
FPGDQVMSPCHSCVCQRGSFQCTLHPCASTCTAYGDRHYRTFDGLPFDFVGACKVHLVKS
TSDFSFSVMVENVNCYGSGIICRKFISINVGNSLIIFDDDSGSPSPESFLDEKQEVHTWR
AGFFTLVHFPREHITLLWDQRTTVHIQAGPQWQGQLTGLCGNFDLKTINEMRTPENLELT
NPQEFGGSWAAVECPDTLDPRDTCVLNPLREPFAKKECSILLSEVFETCHPVVDVTWFYS
NCLTDTCGCSRGGDCECFCASVSAYAHQCCQHGVAVDWRTPRLCPYDCEFFNKALGKGPY
QLASLAAGGALVAVKAAGSAIDLVRAEDVVPGDIVNFLLTAALFKAKAHDPDVVSLEAAD
RPNFFLHATANGSVQLAKWQASDAFHHQASFALHRGTWRAGLVALESLAEPGAFLYVSGP
VLALRLYKRTEAFRRGTLFRLLDAKPSGAAYPPCEWHYDACASPCFRTCRDPWAASCRDV
PRIEGCVPACPTPRVLDEVTQRCVYLEDCVEPAVWVPTEALSNETLPSSQELPTPGDEEL
QLPQEVPGATPHRPAFTPAAPVTTALNPPMAATEGPTLPPGPTQATLQQPLVVTASNLPA
QPTDALTTKGVTASHLATPGAPEPSSLPLSQQMLTSGMWPGAMETTKVTVTFAGVPNMTN
STPSPAVPRFPLVTKAVTVLGPGSLPVTTTTHQPVPSLELPASPSSRPVASPAVTSRPPT
SSGPHEALPTPAITQRMTGTGISQPVQAQNFSGPSSPPAEARTAAEQIPVSPLTTKKVET
STERVQPGPGQPMGPPAAPLPSPVPTALPHPTQHATTAAWPPALPLGSTAATSLSTAAHR
LGATPFTSLESTQPPQLLSGLLPDTSLPLAKVGTSAPVATPGPKGSAVTPPLQQQAASLP
VAATPPARTLSPALLLTPAVMAQAHRPSHVVSQATGTAPGQLLGATLPASGVIAVAEGVA
SPASVAPQKSTTEKMAVLSKQVSLPPWIYGSAQGGPTELTPAVAHTLATLVMEAEGPWAS
TLTPMPTSYSLSRVSARTASRESSLVLLPQLPEAHGTSAGPQPPAELEGEATTQQSGRSA
PAQSILEGSAEALAATAEANTSAACMPIAEQDCIRHICLEGQLIRVNQSQHCPQGAAPPQ
CGVLGLAVRVGGDRCCPIWECACRCSIFPDLSFVTFDGSHAALFKEAIYILSQSPDETIT
VHVLDCKSANLGHLNWPPFCLVMLNVTHLTHQVTIDRFTRKVSVNSQPVWPPVSRLGFRI
EDTGHMYLIRTPSHVQIQWLHSSGLMILEATKASKAQGRGLCGICDGDAANDLTLEDGSV
LGEAEDPAPFLDSWQVPSSLTSMGQTRFRPDSCATADCSPCLRMVSNRTFSACHRFVPPE
SFCELWIRDTKYVQQPCVALTVYVAMCHKFHVCIEWRRSDYCPFLCSSDSTYQACVAACQ
PPETCQDGLLGPLDPEQCQVLGEGCVCSEGTILHRRHSGLCIPEEKCACTDSMGVPRALG
ETWNSSLSGCCQHQCQAPGTIVPVDLGCPDPRPESCPRFGEVALLLPTKDPCCLGTVCVC
NQTLCEGLAPTCSPGHRLLTHFQEDSCCPSYSCECDPDLCEAELVPSCRQDQILIAGRLG
DSCCTSYFCACGDCPDPIPECQEGEALTVDRNTTELCCPLYQCVCESFRCPQVHCGLGTA
LVEVWSPDRCCPYKSCECDCDTIPVPRCHLWEKSQLDEAFMHSVENVCGCAKYECVKAPV
CLSRELGVMQPGQTVVELSADGVCHTSRCTDLLDPLTSFYQINTTSVLCDVHCEANQEYE
HPRDLAACCGSCRNVSCLFTFPNGTTSLFLPGASWIADCTRHHCSSTPLGAVLVRSPISC
PPLNETECAKVGGSVVPSLEGCCRTCKEDGRSCKKVTIRMTIRKNECRSNTPVNLVSCDG
RCPSASIYNYNINTYARFCKCCREVGLQRRSVQLFCATNGTWVPYTVQEPTDCACQWS
Download sequence
Identical sequences ENSSSCP00000024487 ENSSSCP00000024487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]