SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024489 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024489
Domain Number 1 Region: 114-285
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 7.06e-51
Family NadC C-terminal domain-like 0.0000274
Further Details:      
 
Domain Number 2 Region: 10-113
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 9.81e-25
Family NadC N-terminal domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024489   Gene: ENSSSCG00000027454   Transcript: ENSSSCT00000028901
Sequence length 299
Comment pep:known chromosome:Sscrofa10.2:3:18589508:18591847:-1 gene:ENSSSCG00000027454 transcript:ENSSSCT00000028901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLPGLALLLPPATLATLADSWLREDCPGLNPVALVTGAAPSQAVLWAKSPGVLAGRPFF
DAIFAQVNCQVSWFLPEGSKLVPVAKVAEVQGPAHCLLLGERVALNMLARCSGVASAAAT
AVETARGTGWAGHVAGTRKTTPGFRLVEKYGLLVGGATSHRYDLGGLVMVKDNHVVAAGG
VEQAVQGARRAANFALKVEVECSSLQEALEAAEAGADLVLLDNFRPEELHPTAAALKAQF
PTVGVEASGGVTLDNLPQFCGPHIDVISLGMLTQAAPALDFSLKLFAEGTTPVPYARKS
Download sequence
Identical sequences ENSSSCP00000024489 ENSSSCP00000024489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]