SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024494 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024494
Domain Number 1 Region: 19-248
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.39e-64
Family Eukaryotic proteases 0.000000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024494   Gene: ENSSSCG00000029130   Transcript: ENSSSCT00000027015
Sequence length 267
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:77481640:77483778:1 gene:ENSSSCG00000029130 transcript:ENSSSCT00000027015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQSCRPSSPALAPVLLTLLLGGPALASEIVGGRPARPHAWPFMASLQRRGSHFCGGTLI
ARNFVLSAAHCLNGLNFRSVRVVLGAHNLRRGESTRQKFRIQRVFENGFDPMTLRNDIVV
LQLNRFAFINSNVQVAQLPAQDQGVGEGVRCLAMGWGQLGTNRPPPRVLQQLNVTVVTAL
CRPTNVCTLVPGRQAGICFGDSGGPLVCNGLVQGIDSFIRGGCGSGLFPDTFASTAKFAD
WINSIIRRYGDNDSPPLHPRIPVGRTL
Download sequence
Identical sequences A0A286ZN14
ENSSSCP00000024494 ENSSSCP00000024494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]