SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024562 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024562
Domain Number 1 Region: 75-362
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-82
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024562   Gene: ENSSSCG00000022577   Transcript: ENSSSCT00000024208
Sequence length 517
Comment pep:novel chromosome:Sscrofa10.2:15:43390499:43392052:1 gene:ENSSSCG00000022577 transcript:ENSSSCT00000024208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVASLGWGQERLPNIFPPKRTSPWSAAAVDLPWGPSGPEKPSPSSQALCNQQADAAPVA
AVGPVPTKGPLSWRPSVVGAGLQNLGNTCYVNAVLQCLTHTPPLAISLLNGQHQRACQKQ
PFCMLCAVRAHVTRALLHPGDVIQPRKDLVASFHRHRQEDAHEFLMFALDAMQRCPSEDT
LIQQIFGGCWRSQIQCLRCLGVSDTFDPYLDVTLDITAAQSVEQALRELVKAEKLDGENA
YHCGVCLRKGPATKRLTLHRASKVLILVLKRFTDVTGDKMDKKVRYPEHLDLQPYLSVQK
AGALDYELFAVLVHSGWTCHQGHYFCYIRAGNGWWYRMDDSKVTACDTASALSQSAYVLF
YIQRGELERATGGASADRAPRSPGADPIGRDAAVGEPRSPSSIRVSASEGPLAETDIQEI
TLEQWRRHQEHSRPKAEFNLRKVEPALPTNAVVIHRSKFGDGTGRKLPAQENCGVSTSTR
DAPPEGATNMGSIPCLEGRTKASKKKNKKKQRPLALQ
Download sequence
Identical sequences I3LKE8
ENSSSCP00000024562 ENSSSCP00000024562 XP_020937407.1.46622 XP_020937408.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]