SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024720 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024720
Domain Number 1 Region: 60-265
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.58e-43
Family Reprolysin-like 0.0039
Further Details:      
 
Domain Number 2 Region: 364-419
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000732
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 723-785
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 4 Region: 1052-1107
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 5 Region: 993-1049
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 6 Region: 1263-1375
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000523
Family Spermadhesin, CUB domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000024720
Domain Number - Region: 1158-1254
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000129
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number - Region: 879-929
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00327
Family TSP-1 type 1 repeat 0.0079
Further Details:      
 
Domain Number - Region: 931-989
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00445
Family TSP-1 type 1 repeat 0.009
Further Details:      
 
Domain Number - Region: 666-724
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0549
Family TSP-1 type 1 repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024720   Gene: ENSSSCG00000021241   Transcript: ENSSSCT00000022734
Sequence length 1391
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:306998075:307029937:1 gene:ENSSSCG00000021241 transcript:ENSSSCT00000022734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRGILTSLFLLGCWGLSRFPQLFLQALEPEEVTAYLGPAAALEGRPPARRLWRRAAGSVL
HLELLVAVGPDVQQAHQEDTERYVLTNLNMGSELLRDPSLGAQFRVHLVKMVILTQPQDA
PNITANITASLRSVCEWSRTVNPEDDADPSHADLVLYITRFDLELPDGNRQVRGVTQLGG
ACSSSWSCLITEDTGFDLGVTIAHEIGHSFGLEHDGAPGSDCEASGHVMASDGAAPARGG
PTWSPCSRRQLQRMLSAGRPHCVWDPPGPQSWAAGRPPEAHPGLYYGADEQCRVAFGPTA
VACTFAREQLDMCQALSCHTDPLDQSSCSRLLIPLLDGTECGVGKWCSKGHCRSLAELAP
VGAVHGGWSSWGPASPCSRSCGGGVVTRRRQCNNPRPAFGGRSCVGADLQAEMCNTQACE
KTQLEFMSQQCAQTDGEPLRLSPGSTSFYHWGAAAQYSQGDTLCRHMCWAVGESFIVRRG
DRFLDGTRCVPGGPRQDGTLSLCVSGSCAQTFGCDGRMDSGQVPDMCQVCGGDNSTCRPQ
NGSFTAGRAREYVTFLTVTPNLTNIHVINHRPLFTHLAVRIRGRYVVAGNASISPSITYP
SLLEDSRVEYRVALTEDRLPHREELRIRGPTQEDLEIQVYRRYGQEYGRLARPDITFTYF
QPEQQQAWAWAPVRGACSVSCGAGLRQVTYSCWDQARNAWVEAALCAGSRRPAAWSESCT
PAPCPPFWAVGDFGPCSASCGGGLQERAVRCVEAQGGLLRTLPRLRCRALAQQPAAVETC
NAQPCPTRETSDTCPSACGAELAVQNVTCVQGAEGMGALATAGPCPTDQKPSALEPCIEV
TCPPGWGHLEAQSPGEEAVSPAGSARLEVQAAHVWTPLTGPCSVSCGQGLMELYFVCVDS
ALGTPVQEEMCDLAARPGRRQEVCQAAPCPAWWETRALAPCPVTCGGGQVPLAVRCVRMD
RGRLVPLPHAKCWPLPRPRPFEDCSPEPCPARWKVTSLGLCSASCGLGTATRSVACVQLD
QGRDTEVDGAACAGLVRPQASIPCVVADCAFRWHVGAWMQCSVSCGDGIQRRHDACLGPQ
AQVPVPAVFCQHLPKPVTVQGCWAGPCAGQRTPSPASLEEATAPSQTTAATAGASPAWPQ
RGDRLLSLHPQEGPAESSACGQQYLEPTGTIDMRGPEQADCAVVIGRPLGEVVTLRVLES
SLNCSAGEMLLLWGRLTWRKKCERLSGMTFSTKANTLMVRQRLVQLGGGVLLRYSSQPAP
GTFHRECDMQLFGPRGEIVSPSTSPDGRHVGGCRIFISVAPRARIAIHALVTDAATGTDG
TDASYVLIRDIHSLRTTAFHGQQTLYWESEGSQAEMEFSQGFLDAHTSLRGQYWTLQKPT
PRQAGDSLATA
Download sequence
Identical sequences ENSSSCP00000024720 ENSSSCP00000024720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]